UniProt ID | S35B1_HUMAN | |
---|---|---|
UniProt AC | P78383 | |
Protein Name | Solute carrier family 35 member B1 | |
Gene Name | SLC35B1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 322 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Probable sugar transporter.. | |
Protein Sequence | MASSSSLVPDRLRLPLCFLGVFVCYFYYGILQEKITRGKYGEGAKQETFTFALTLVFIQCVINAVFAKILIQFFDTARVDRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTVGYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGTVLVFLGLGLDAKFGKGAKKTSH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | VPDRLRLPLCFLGVF CCCHHHHHHHHHHHH | 22.20 | - | |
15 (in isoform 2) | Phosphorylation | - | 22.20 | 22199227 | |
27 | Phosphorylation | GVFVCYFYYGILQEK HHHHHHHHHHHHHHH | 3.70 | 27251275 | |
27 (in isoform 2) | Phosphorylation | - | 3.70 | 30266825 | |
29 | Phosphorylation | FVCYFYYGILQEKIT HHHHHHHHHHHHHHH | 11.62 | - | |
29 (in isoform 2) | Phosphorylation | - | 11.62 | 30266825 | |
33 (in isoform 2) | Phosphorylation | - | 42.87 | 30266825 | |
34 (in isoform 2) | Phosphorylation | - | 36.09 | 30266825 | |
300 | Phosphorylation | SPMQWVGTVLVFLGL CHHHHHHHHHHHHCC | 10.88 | - | |
337 | Phosphorylation | ---------------------- ---------------------- | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35B1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35B1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35B1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...