| UniProt ID | S35A3_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y2D2 | |
| Protein Name | UDP-N-acetylglucosamine transporter | |
| Gene Name | SLC35A3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 325 | |
| Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . |
|
| Protein Description | Uridine diphosphate-N-acetylglucosamine (UDP-GlcNAc) transporter in the Golgi apparatus. May supply UDP-GlcNAc as substrate for Golgi-resident glycosyltransferases that generate branching of diantennary oligosaccharides.. | |
| Protein Sequence | MFANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAGNPTKA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MFANLKYVSLGILV -CCCCCEEEEECEEE | 9.84 | 24043423 | |
| 8 (in isoform 2) | Phosphorylation | - | 3.49 | 26657352 | |
| 8 | Phosphorylation | MFANLKYVSLGILVF CCCCCEEEEECEEEE | 3.49 | 27251275 | |
| 9 | Phosphorylation | FANLKYVSLGILVFQ CCCCEEEEECEEEEE | 20.14 | 24043423 | |
| 17 | Phosphorylation | LGILVFQTTSLVLTM ECEEEEEHHHHHHHH | 13.59 | 24043423 | |
| 18 | Phosphorylation | GILVFQTTSLVLTMR CEEEEEHHHHHHHHH | 14.85 | 27762562 | |
| 19 | Phosphorylation | ILVFQTTSLVLTMRY EEEEEHHHHHHHHHH | 21.62 | 24043423 | |
| 23 | Phosphorylation | QTTSLVLTMRYSRTL EHHHHHHHHHHHCCC | 7.66 | 24043423 | |
| 26 | Phosphorylation | SLVLTMRYSRTLKEE HHHHHHHHHCCCCHH | 7.53 | 24043423 | |
| 27 | Phosphorylation | LVLTMRYSRTLKEEG HHHHHHHHCCCCHHC | 14.39 | 24043423 | |
| 80 | Ubiquitination | LHDEILNKPMETLKL HCHHHHCCCHHHHHH | 42.15 | 2190698 | |
| 80 (in isoform 1) | Ubiquitination | - | 42.15 | 21906983 | |
| 80 | Ubiquitination | LHDEILNKPMETLKL HCHHHHCCCHHHHHH | 42.15 | 21906983 | |
| 122 (in isoform 2) | Ubiquitination | - | 3.13 | 21906983 | |
| 133 | Phosphorylation | LFSVSMLSKKLGVYQ HHHHHHHHHHHCHHH | 21.07 | 24260401 | |
| 139 | Phosphorylation | LSKKLGVYQWLSLVI HHHHHCHHHHHHHHH | 7.68 | - | |
| 143 | Phosphorylation | LGVYQWLSLVILMTG HCHHHHHHHHHHHHC | 20.03 | - | |
| 160 | Phosphorylation | FVQWPSDSQLDSKEL HHCCCCCCCCCCCCC | 36.66 | - | |
| 200 | Phosphorylation | FEKILKETKQSVWIR HHHHHHHHHHCHHEE | 32.56 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35A3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35A3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35A3_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 615553 | Arthrogryposis, mental retardation, and seizures (AMRS) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
