| UniProt ID | S35A1_HUMAN | |
|---|---|---|
| UniProt AC | P78382 | |
| Protein Name | CMP-sialic acid transporter | |
| Gene Name | SLC35A1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 337 | |
| Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein. |
|
| Protein Description | Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function.. | |
| Protein Sequence | MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Phosphorylation | LYCLAVMTLMAAVYT HHHHHHHHHHHHHHH | 13.54 | 25072903 | |
| 27 | Phosphorylation | MTLMAAVYTIALRYT HHHHHHHHHHHHHCC | 6.41 | 23663014 | |
| 28 | Phosphorylation | TLMAAVYTIALRYTR HHHHHHHHHHHHCCC | 7.99 | 23663014 | |
| 33 | Phosphorylation | VYTIALRYTRTSDKE HHHHHHHCCCCCCCC | 11.04 | 23663014 | |
| 34 | Phosphorylation | YTIALRYTRTSDKEL HHHHHHCCCCCCCCE | 22.49 | 23663014 | |
| 84 | Phosphorylation | LRENVLGSPKELLKL HHHHCCCCHHHHHHC | 28.74 | 22985185 | |
| 86 | Ubiquitination | ENVLGSPKELLKLSV HHCCCCHHHHHHCCH | 63.79 | 29967540 | |
| 272 | Ubiquitination | KYTDNIMKGFSAAAA EECCCCCCHHHHHHH | 53.67 | 33845483 | |
| 331 | Ubiquitination | QQGETASKERVIGV- CCCCCCCCCCCCCC- | 47.26 | 33845483 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35A1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35A1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35A1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GCP60_HUMAN | ACBD3 | physical | 26186194 | |
| ICK_HUMAN | ICK | physical | 28514442 | |
| CASP3_HUMAN | CASP3 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
