UniProt ID | S35A1_HUMAN | |
---|---|---|
UniProt AC | P78382 | |
Protein Name | CMP-sialic acid transporter | |
Gene Name | SLC35A1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 337 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein. |
|
Protein Description | Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function.. | |
Protein Sequence | MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | LYCLAVMTLMAAVYT HHHHHHHHHHHHHHH | 13.54 | 25072903 | |
27 | Phosphorylation | MTLMAAVYTIALRYT HHHHHHHHHHHHHCC | 6.41 | 23663014 | |
28 | Phosphorylation | TLMAAVYTIALRYTR HHHHHHHHHHHHCCC | 7.99 | 23663014 | |
33 | Phosphorylation | VYTIALRYTRTSDKE HHHHHHHCCCCCCCC | 11.04 | 23663014 | |
34 | Phosphorylation | YTIALRYTRTSDKEL HHHHHHCCCCCCCCE | 22.49 | 23663014 | |
84 | Phosphorylation | LRENVLGSPKELLKL HHHHCCCCHHHHHHC | 28.74 | 22985185 | |
86 | Ubiquitination | ENVLGSPKELLKLSV HHCCCCHHHHHHCCH | 63.79 | 29967540 | |
272 | Ubiquitination | KYTDNIMKGFSAAAA EECCCCCCHHHHHHH | 53.67 | 33845483 | |
331 | Ubiquitination | QQGETASKERVIGV- CCCCCCCCCCCCCC- | 47.26 | 33845483 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35A1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35A1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35A1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GCP60_HUMAN | ACBD3 | physical | 26186194 | |
ICK_HUMAN | ICK | physical | 28514442 | |
CASP3_HUMAN | CASP3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...