| UniProt ID | S2536_HUMAN | |
|---|---|---|
| UniProt AC | Q96CQ1 | |
| Protein Name | Solute carrier family 25 member 36 | |
| Gene Name | SLC25A36 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 311 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | Mitochondrial transporter that imports/exports pyrimidine nucleotides into and from mitochondria. Transports preferentially cytosine and uracil (deoxy)nucleoside mono-, di-, and triphosphates by uniport and antiport mechanism. Also transports guanine but not adenine (deoxy)nucleotides. Is inhibited strongly by pyridoxal 5'-phosphate, 4,7-diphenyl-1,10-phenanthroline, tannic acid, and mercurials (mercury dichloride, Mersalyl acid, p-hydroxymercuribenzoate). Participates in mitochondrial genome maintenance, regulation of mitochondrial membrane potential and mitochondrial respiration.. | |
| Protein Sequence | MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYLLNG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 50 | Phosphorylation | ISEVQLNTMAGASVN EEEEEHHHCCCCCCC | 19.59 | 28787133 | |
| 51 (in isoform 4) | Ubiquitination | - | 2.93 | 21906983 | |
| 61 | Phosphorylation | ASVNRVVSPGPLHCL CCCCCCCCCCCHHHH | 22.68 | 28787133 | |
| 74 | Ubiquitination | CLKVILEKEGPRSLF HHHHHHHHCCCCHHH | 65.61 | - | |
| 94 | Phosphorylation | NLVGVAPSRAIYFAA CCEEECCHHHHHHHH | 25.30 | - | |
| 177 | Phosphorylation | TDGLKGFYRGMSASY CCCCHHHHHCCCHHH | 18.22 | 18083107 | |
| 184 | Phosphorylation | YRGMSASYAGISETV HHCCCHHHHCCCHHH | 14.46 | 18083107 | |
| 203 | Ubiquitination | IYESIKQKLLEYKTA HHHHHHHHHHHHHCC | 50.46 | - | |
| 207 | Phosphorylation | IKQKLLEYKTASTME HHHHHHHHHCCCCCC | 17.38 | 21214269 | |
| 208 | Ubiquitination | KQKLLEYKTASTMEN HHHHHHHHCCCCCCC | 28.39 | 2190698 | |
| 208 (in isoform 1) | Ubiquitination | - | 28.39 | 21906983 | |
| 208 (in isoform 3) | Ubiquitination | - | 28.39 | 21906983 | |
| 211 | Phosphorylation | LLEYKTASTMENDEE HHHHHCCCCCCCCHH | 33.25 | 30576142 | |
| 219 | Phosphorylation | TMENDEESVKEASDF CCCCCHHHHHHHHHH | 36.12 | 21214269 | |
| 236 | Phosphorylation | MMLAAATSKTCATTI HHHHHHHCCCCCCCC | 22.65 | 30576142 | |
| 238 | Phosphorylation | LAAATSKTCATTIAY HHHHHCCCCCCCCCC | 13.72 | 30576142 | |
| 241 | Phosphorylation | ATSKTCATTIAYPHE HHCCCCCCCCCCCHH | 22.38 | 30576142 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S2536_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S2536_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S2536_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
