UniProt ID | S10AA_MOUSE | |
---|---|---|
UniProt AC | P08207 | |
Protein Name | Protein S100-A10 | |
Gene Name | S100a10 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 97 | |
Subcellular Localization | ||
Protein Description | Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.. | |
Protein Sequence | MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | QMEHAMETMMLTFHR HHHHHHHHHHHHHHH | 8.52 | 28638064 | |
15 | Phosphorylation | AMETMMLTFHRFAGD HHHHHHHHHHHHHCC | 10.25 | 28638064 | |
23 | Acetylation | FHRFAGDKDHLTKED HHHHHCCHHHCCHHH | 46.24 | 23806337 | |
28 | Acetylation | GDKDHLTKEDLRVLM CCHHHCCHHHHHHHH | 56.44 | 22826441 | |
47 | Ubiquitination | PGFLENQKDPLAVDK CCHHHCCCCHHHHHH | 73.27 | 22790023 | |
47 | Acetylation | PGFLENQKDPLAVDK CCHHHCCCCHHHHHH | 73.27 | 23236377 | |
54 | Acetylation | KDPLAVDKIMKDLDQ CCHHHHHHHHHHHHH | 37.79 | 22826441 | |
54 | Ubiquitination | KDPLAVDKIMKDLDQ CCHHHHHHHHHHHHH | 37.79 | 22790023 | |
57 | Acetylation | LAVDKIMKDLDQCRD HHHHHHHHHHHHCCC | 59.62 | 22826441 | |
57 | Ubiquitination | LAVDKIMKDLDQCRD HHHHHHHHHHHHCCC | 59.62 | 22790023 | |
62 | S-nitrosocysteine | IMKDLDQCRDGKVGF HHHHHHHCCCCCCCH | 4.23 | - | |
62 | Glutathionylation | IMKDLDQCRDGKVGF HHHHHHHCCCCCCCH | 4.23 | 24333276 | |
62 | S-nitrosylation | IMKDLDQCRDGKVGF HHHHHHHCCCCCCCH | 4.23 | 21278135 | |
92 | Acetylation | DYFVVNMKQKGKK-- CEEEEECHHCCCC-- | 43.59 | 15617147 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S10AA_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S10AA_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S10AA_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ANXA2_MOUSE | Anxa2 | physical | 23415230 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...