UniProt ID | S10A3_HUMAN | |
---|---|---|
UniProt AC | P33764 | |
Protein Name | Protein S100-A3 | |
Gene Name | S100A3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 101 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.. | |
Protein Sequence | MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MARPLEQAV ------CCCHHHHHH | 23.07 | 12470658 | |
51 | Citrullination | TWTPTEFRECDYNKF CCCCHHHHHCCHHHH | 37.08 | - | |
51 | Citrullination | TWTPTEFRECDYNKF CCCCHHHHHCCHHHH | 37.08 | 18083705 | |
60 | Phosphorylation | CDYNKFMSVLDTNKD CCHHHHHHHHCCCCC | 23.74 | 20068231 | |
95 | Phosphorylation | EYFKDCPSEPPCSQ- HHHHCCCCCCCCCC- | 69.90 | 28102081 | |
100 | Phosphorylation | CPSEPPCSQ------ CCCCCCCCC------ | 44.70 | 28985074 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S10A3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
51 | R | Citrullination |
| 18083705 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S10A3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
S10A3_HUMAN | S100A3 | physical | 12045193 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...