dbPTM

S10A3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	S10A3_HUMAN
UniProt AC	P33764
Protein Name	Protein S100-A3
Gene Name	S100A3
Organism	Homo sapiens (Human).
Sequence Length	101
Subcellular Localization	Cytoplasm .
Protein Description	Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation..
Protein Sequence	MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MARPLEQAV ------CCCHHHHHH	23.07	12470658
51	Citrullination	TWTPTEFRECDYNKF CCCCHHHHHCCHHHH	37.08	-
51	Citrullination	TWTPTEFRECDYNKF CCCCHHHHHCCHHHH	37.08	18083705
60	Phosphorylation	CDYNKFMSVLDTNKD CCHHHHHHHHCCCCC	23.74	20068231
95	Phosphorylation	EYFKDCPSEPPCSQ- HHHHCCCCCCCCCC-	69.90	28102081
100	Phosphorylation	CPSEPPCSQ------ CCCCCCCCC------	44.70	28985074

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of S10A3_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
51	R	Citrullination		18083705
Arg-51 is specifically citrullinated by PAD3 and promotes tetramerization.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of S10A3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
S10A3_HUMAN	S100A3	physical	12045193

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of S10A3_HUMAN

Related Literatures of Post-Translational Modification