UniProt ID | RUP2_ARATH | |
---|---|---|
UniProt AC | Q9FFA7 | |
Protein Name | WD repeat-containing protein RUP2 | |
Gene Name | RUP2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 368 | |
Subcellular Localization | Nucleus . Cytoplasm, cytosol . | |
Protein Description | Functions in association with RUP1 as repressor of UV-B-induced photomorphogenesis mediated by UVR8 and HY5. Plays a crucial negative feedback regulatory role downstream of UVR8-COP1 to inhibit UVR8 function, balance UV-B-specific responses and ensure normal plant growth. Is involved in the regulation of photoperiodic flowering and vegetative development. May act as negative regulator of photoperiodic flowering by suppressing flowering through the action of CONSTANS (CO) and FLOWERING LOCUS T (FT).. | |
Protein Sequence | MNTLHPHKQQQEQAQQQEEARYEWDLSLSTVVSSSSSSASDVIGAIEFDPTDNIVATAGISRKIRFYGLPSLLRNNAVSGTGVSFVDQATACEYYICTPAKLSSLRWRPGSGGRVIGSGDYDGVVMEYDLEKRTPVFERDEHGGRRVWSVDYTRHGGASTVGASGSDDGTMQVWDPRCPPEESVGVVRPAGICRSAVCCVEFDPSGGPAVAVGCADRKGYVYDIRKLVDPALTLQGHTKTVSYVRFLDGGTVVTAGTDGCLKLWSVEDGRVIRTYEGHVNNRNFVGLSVWRNGALFGCGSENNRVFVYDRRWGKPVWVDGFEPVGMNSGSDKRFVSSVCWRQSGVDQCTLVAGGSDGVLQVYVGKRKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RUP2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RUP2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RUP2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UVR8_ARATH | UVR8 | physical | 21041653 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...