dbPTM

RU2B1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RU2B1_ARATH
UniProt AC	O22922
Protein Name	U2 small nuclear ribonucleoprotein B''
Gene Name	U2B''
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	232
Subcellular Localization	Nucleus, Cajal body . Nucleus, nucleoplasm . Cytoplasm . Present in coiled bodies and an interchromatin network. Redistributed throughout the cytoplasm upon entry into mitosis. Also detected in central nucleolar vacuole.
Protein Description	Involved in nuclear pre-mRNA splicing..
Protein Sequence	MLTADIPPNQSIYIQNLNERIKKEELKRSLYCLFSQFGRILDVVALKTPKLRGQAWVTFSEVTAAGHAVRQMQNFPFYDKPMRLQYAKAKSDCLAKAEGTFVPKDKKRKQEEKVERKREDSQRPNTANGPSANGPSANNGVPAPSFQPSGQETMPPNNILFIQNLPHETTSMMLQLLFEQYPGFKEIRMIDAKPGIAFVEYEDDVQASIAMQPLQGFKITPQNPMVISFAKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RU2B1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RU2B1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RU2B1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RU2B1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TCP14_ARATH	TCP14	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RU2B1_ARATH

Related Literatures of Post-Translational Modification