dbPTM

RT02_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RT02_ARATH
UniProt AC	Q9GCB9
Protein Name	Ribosomal protein S2, mitochondrial
Gene Name	RPS2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	219
Subcellular Localization	Mitochondrion.
Protein Description
Protein Sequence	MTIHAAVIQKLLNTGAHLGRRAAEHHFKQYAYGTRNGMTIIDSDKTLICLRSAAHFVANLAHMRGNIFFVNTNPLFDEIIELTSRRIQGDSYNHNRAMNLWKMGGFLTNSYSPKKFRSRHKKLCFGPTTMPDCVVVFDSERKSSVILEASKLQIPVVAIVDPNVPLEFFEKITYPVPARDSVKFVYLFCNVITKCFVAEQMKLGIKEGSNEDLMKDLAA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
111	Phosphorylation	GGFLTNSYSPKKFRS CCHHCCCCCCHHHHH	30.94	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RT02_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RT02_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RT02_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CP18C_ARATH	ROC1	physical	25299333

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RT02_ARATH

Related Literatures of Post-Translational Modification