RSRC1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RSRC1_MOUSE
• UniProt AC: Q9DBU6
• Protein Name: Serine/Arginine-related protein 53
• Gene Name: Rsrc1
• Organism: Mus musculus (Mouse).
• Sequence Length: 334
• Subcellular Localization: Nucleus . Nucleus speckle . Cytoplasm . Shuttles between the nucleus and cytoplasm.
• Protein Description: Plays a role in pre-mRNA splicing. Involved in both constitutive and alternative pre-mRNA splicing. May have a role in the recognition of the 3' splice site during the second step of splicing (By similarity)..
• Protein Sequence: MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRSRSRGRGKPYRVQRSRSKSRTRRSRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDKEKREKEKDKGKDKEVHSIKRGDSGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALKAKERSEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKDVKKAVEPSEVQHVTAASGPASAAAEPPSTGKEIDPDSIPTAIKYQDDNSLAHPNLFIEKAEAEEKWFKRLIALRQERLMGSPVA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MGRRSSDTEEES ---CCCCCCCCHHHH	31.07	23684622
6	Phosphorylation	--MGRRSSDTEEESR --CCCCCCCCHHHHH	46.90	27087446
8	Phosphorylation	MGRRSSDTEEESRSK CCCCCCCCHHHHHHH	47.44	23684622
12	Phosphorylation	SSDTEEESRSKRKKK CCCCHHHHHHHHHHH	45.17	20415495
48	Phosphorylation	GRRPRSDSRSWSRDR CCCCCCCCCCCCHHH	29.47	29514104
52	Phosphorylation	RSDSRSWSRDRQLRS CCCCCCCCHHHHHHH	26.08	29514104
59	Phosphorylation	SRDRQLRSHSYERRR CHHHHHHHHHHHHHH	25.94	28285833
61	Phosphorylation	DRQLRSHSYERRRRR HHHHHHHHHHHHHHH	29.90	27717184
62	Phosphorylation	RQLRSHSYERRRRRR HHHHHHHHHHHHHHH	14.18	29514104
70	Phosphorylation	ERRRRRRSSSSSSYG HHHHHHHCCCCCCHH	32.53	22871156
74	Phosphorylation	RRRSSSSSSYGSRRK HHHCCCCCCHHHHHH	29.53	22871156
78	Phosphorylation	SSSSSYGSRRKRSRS CCCCCHHHHHHHHCC	22.22	22871156
237	Phosphorylation	KEIEAIESDSFVQQT HHHHHHHCCHHHHHH	32.23	28066266
239	Phosphorylation	IEAIESDSFVQQTFR HHHHHCCHHHHHHHH	36.27	28066266
271	Phosphorylation	TAASGPASAAAEPPS EECCCCCCCCCCCCC	22.90	25338131
331	Phosphorylation	RQERLMGSPVA---- HHHHHCCCCCC----	11.39	25521595

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RSRC1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RSRC1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RSRC1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SRSF1_MOUSE	Srsf1	physical	15798186
RBM39_MOUSE	Rbm39	physical	15798186

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry.";
Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.;
J. Proteome Res. 7:5314-5326(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6, AND MASSSPECTROMETRY.
PubMed: 19367708