UniProt ID | RS4_DROME | |
---|---|---|
UniProt AC | P41042 | |
Protein Name | 40S ribosomal protein S4 | |
Gene Name | RpS4 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 261 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAEVTKIVMQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQLGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAEERDKRLAAKTH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Acetylation | LKRLAAPKAWMLDKL HHHHHCCCHHHHHHH | 50.37 | 21791702 | |
22 | Acetylation | PKAWMLDKLGGVFAP CCHHHHHHHCCEECC | 45.10 | 21791702 | |
32 | Phosphorylation | GVFAPRPSTGPHKLR CEECCCCCCCCCCHH | 47.47 | 21082442 | |
33 | Phosphorylation | VFAPRPSTGPHKLRE EECCCCCCCCCCHHH | 58.37 | 21082442 | |
120 | Acetylation | RISAEEAKYKLCKVK ECCHHHHHHHEECEE | 46.31 | 21791702 | |
134 | Acetylation | KKTQLGAKGVPFLVT ECCCCCCCCCCEEEE | 59.65 | 21791702 | |
223 | Phosphorylation | HVFATRLTNVFIIGK CEEEEEEEEEEEECC | 26.50 | 21082442 | |
233 | Acetylation | FIIGKGNKPYISLPK EEECCCCCCEEECCC | 48.11 | 21791702 | |
247 | Phosphorylation | KGKGVKLSIAEERDK CCCCEECEECHHHHH | 17.65 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS4_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS4_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS4_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...