| UniProt ID | RS4_DROME | |
|---|---|---|
| UniProt AC | P41042 | |
| Protein Name | 40S ribosomal protein S4 | |
| Gene Name | RpS4 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 261 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAEVTKIVMQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQLGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAEERDKRLAAKTH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Acetylation | LKRLAAPKAWMLDKL HHHHHCCCHHHHHHH | 50.37 | 21791702 | |
| 22 | Acetylation | PKAWMLDKLGGVFAP CCHHHHHHHCCEECC | 45.10 | 21791702 | |
| 32 | Phosphorylation | GVFAPRPSTGPHKLR CEECCCCCCCCCCHH | 47.47 | 21082442 | |
| 33 | Phosphorylation | VFAPRPSTGPHKLRE EECCCCCCCCCCHHH | 58.37 | 21082442 | |
| 120 | Acetylation | RISAEEAKYKLCKVK ECCHHHHHHHEECEE | 46.31 | 21791702 | |
| 134 | Acetylation | KKTQLGAKGVPFLVT ECCCCCCCCCCEEEE | 59.65 | 21791702 | |
| 223 | Phosphorylation | HVFATRLTNVFIIGK CEEEEEEEEEEEECC | 26.50 | 21082442 | |
| 233 | Acetylation | FIIGKGNKPYISLPK EEECCCCCCEEECCC | 48.11 | 21791702 | |
| 247 | Phosphorylation | KGKGVKLSIAEERDK CCCCEECEECHHHHH | 17.65 | 21082442 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS4_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS4_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS4_DROME !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...