UniProt ID | RS4Y1_HUMAN | |
---|---|---|
UniProt AC | P22090 | |
Protein Name | 40S ribosomal protein S4, Y isoform 1 | |
Gene Name | RPS4Y1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 263 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Ubiquitination | -MARGPKKHLKRVAA -CCCCCHHHHHHHHC | 58.25 | 24816145 | |
7 | Methylation | -MARGPKKHLKRVAA -CCCCCHHHHHHHHC | 58.25 | 54413993 | |
10 | Ubiquitination | RGPKKHLKRVAAPKH CCCHHHHHHHHCCCC | 44.54 | 23000965 | |
16 | Ubiquitination | LKRVAAPKHWMLDKL HHHHHCCCCHHHHHC | 45.21 | 23000965 | |
16 | Acetylation | LKRVAAPKHWMLDKL HHHHHCCCCHHHHHC | 45.21 | 25825284 | |
19 | Sulfoxidation | VAAPKHWMLDKLTGV HHCCCCHHHHHCCCC | 3.29 | 30846556 | |
19 | Ubiquitination | VAAPKHWMLDKLTGV HHCCCCHHHHHCCCC | 3.29 | 23000965 | |
22 | Acetylation | PKHWMLDKLTGVFAP CCCHHHHHCCCCCCC | 43.94 | 25825284 | |
22 | Ubiquitination | PKHWMLDKLTGVFAP CCCHHHHHCCCCCCC | 43.94 | 23000965 | |
24 | Phosphorylation | HWMLDKLTGVFAPRP CHHHHHCCCCCCCCC | 36.72 | 20363803 | |
25 | Ubiquitination | WMLDKLTGVFAPRPS HHHHHCCCCCCCCCC | 24.00 | 21890473 | |
31 | Ubiquitination | TGVFAPRPSTGPHKL CCCCCCCCCCCCCHH | 34.87 | 21890473 | |
32 | Phosphorylation | GVFAPRPSTGPHKLR CCCCCCCCCCCCHHH | 47.47 | 28450419 | |
33 | Phosphorylation | VFAPRPSTGPHKLRE CCCCCCCCCCCHHHH | 58.37 | 28450419 | |
37 | Acetylation | RPSTGPHKLRECLPL CCCCCCCHHHHHHHH | 52.99 | 25953088 | |
37 | Ubiquitination | RPSTGPHKLRECLPL CCCCCCCHHHHHHHH | 52.99 | 21890473 | |
46 | Ubiquitination | RECLPLIVFLRNRLK HHHHHHHHHHHHCHH | 4.94 | 21890473 | |
53 | Methylation | VFLRNRLKYALTGDE HHHHHCHHHHHHHHH | 25.82 | 164135 | |
53 | Acetylation | VFLRNRLKYALTGDE HHHHHCHHHHHHHHH | 25.82 | 27178108 | |
53 | Ubiquitination | VFLRNRLKYALTGDE HHHHHCHHHHHHHHH | 25.82 | 23000965 | |
54 | Phosphorylation | FLRNRLKYALTGDEV HHHHCHHHHHHHHHH | 16.07 | 28152594 | |
57 | Phosphorylation | NRLKYALTGDEVKKI HCHHHHHHHHHHHHH | 34.12 | 28152594 | |
62 | Ubiquitination | ALTGDEVKKICMQRF HHHHHHHHHHHHHHC | 34.08 | 23000965 | |
62 | Acetylation | ALTGDEVKKICMQRF HHHHHHHHHHHHHHC | 34.08 | 25953088 | |
62 | Neddylation | ALTGDEVKKICMQRF HHHHHHHHHHHHHHC | 34.08 | 32015554 | |
63 | Ubiquitination | LTGDEVKKICMQRFI HHHHHHHHHHHHHCC | 46.44 | 22817900 | |
71 | Ubiquitination | ICMQRFIKIDGKVRV HHHHHCCEECCEEEE | 31.84 | 27667366 | |
71 | Acetylation | ICMQRFIKIDGKVRV HHHHHCCEECCEEEE | 31.84 | 25953088 | |
72 | Ubiquitination | CMQRFIKIDGKVRVD HHHHCCEECCEEEEE | 7.84 | 21890473 | |
75 | Ubiquitination | RFIKIDGKVRVDVTY HCCEECCEEEEEEEE | 24.10 | 24816145 | |
81 | Phosphorylation | GKVRVDVTYPAGFMD CEEEEEEEECCCEEE | 21.23 | 23401153 | |
82 | Phosphorylation | KVRVDVTYPAGFMDV EEEEEEEECCCEEEE | 7.31 | 23401153 | |
84 | Ubiquitination | RVDVTYPAGFMDVIS EEEEEECCCEEEEEE | 17.28 | 24816145 | |
91 | Phosphorylation | AGFMDVISIEKTGEH CCEEEEEEEEECCCC | 25.25 | 23401153 | |
106 | Ubiquitination | FRLVYDTKGRFAVHR EEEEEECCCCEEEEE | 45.23 | - | |
120 | Ubiquitination | RITVEEAKYKLCKVR EEEHHHHHHEEECEE | 46.31 | - | |
120 | Acetylation | RITVEEAKYKLCKVR EEEHHHHHHEEECEE | 46.31 | 25953088 | |
125 | Ubiquitination | EAKYKLCKVRKITVG HHHHEEECEEEEEEE | 56.35 | - | |
134 | Ubiquitination | RKITVGVKGIPHLVT EEEEEECCCCCEEEE | 45.23 | 22817900 | |
143 | Ubiquitination | IPHLVTHDARTIRYP CCEEEECCCCCCCCC | 28.51 | 21890473 | |
145 | Methylation | HLVTHDARTIRYPDP EEEECCCCCCCCCCC | 36.42 | - | |
155 | Methylation | RYPDPVIKVNDTVQI CCCCCEEEECCEEEE | 34.91 | - | |
168 | Ubiquitination | QIDLGTGKIINFIKF EEECCCCCEEEEEEE | 40.01 | 22817900 | |
177 | Phosphorylation | INFIKFDTGNLCMVI EEEEEECCCCEEEEE | 30.97 | 22817900 | |
177 | Ubiquitination | INFIKFDTGNLCMVI EEEEEECCCCEEEEE | 30.97 | 21890473 | |
200 | Methylation | GVITNRERHPGSFDV EEEECCCCCCCCEEE | 37.76 | - | |
204 | Phosphorylation | NRERHPGSFDVVHVK CCCCCCCCEEEEEEE | 23.79 | 20068231 | |
211 | Ubiquitination | SFDVVHVKDANGNSF CEEEEEEECCCCCCC | 35.92 | 23000965 | |
211 | Acetylation | SFDVVHVKDANGNSF CEEEEEEECCCCCCC | 35.92 | 25953088 | |
217 | Phosphorylation | VKDANGNSFATRLSN EECCCCCCCEEEEEE | 20.04 | 20068231 | |
220 | Ubiquitination | ANGNSFATRLSNIFV CCCCCCEEEEEEEEE | 30.08 | 23000965 | |
220 | Phosphorylation | ANGNSFATRLSNIFV CCCCCCEEEEEEEEE | 30.08 | 20068231 | |
223 | Phosphorylation | NSFATRLSNIFVIGN CCCEEEEEEEEEECC | 25.29 | 23663014 | |
233 | Neddylation | FVIGNGNKPWISLPR EEECCCCCCEEECCC | 43.03 | 32015554 | |
233 | Ubiquitination | FVIGNGNKPWISLPR EEECCCCCCEEECCC | 43.03 | 22817900 | |
233 | Acetylation | FVIGNGNKPWISLPR EEECCCCCCEEECCC | 43.03 | 23749302 | |
237 | Phosphorylation | NGNKPWISLPRGKGI CCCCCEEECCCCCCE | 28.58 | 28450419 | |
242 | Ubiquitination | WISLPRGKGIRLTVA EEECCCCCCEEEEEE | 53.06 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS4Y1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS4Y1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS4Y1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RS4Y2_HUMAN | RPS4Y2 | physical | 26186194 | |
RS4Y2_HUMAN | RPS4Y2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...