UniProt ID | RS4Y2_HUMAN | |
---|---|---|
UniProt AC | Q8TD47 | |
Protein Name | 40S ribosomal protein S4, Y isoform 2 | |
Gene Name | RPS4Y2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 263 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQHFLKIDGKVRVDITYPAGFIDVISIEKTGEHFRLVYNTKGCFAVHRITVEEAKYKLCKVRKITVGTKGIPHLVTHDARTIRYPDPLIKVNDTVQIDLGTGKITSFIKFDTGNVCMVIAGANLGRVGVITNRERHPGSCDVVHVKDANGNSFATRISNIFVIGNGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Ubiquitination | -MARGPKKHLKRVAA -CCCCCHHHHHHHHC | 58.25 | 24816145 | |
7 | Methylation | -MARGPKKHLKRVAA -CCCCCHHHHHHHHC | 58.25 | 72616607 | |
10 | Ubiquitination | RGPKKHLKRVAAPKH CCCHHHHHHHHCCCC | 44.54 | 23000965 | |
16 | Acetylation | LKRVAAPKHWMLDKL HHHHHCCCCHHHHHC | 45.21 | - | |
16 | Ubiquitination | LKRVAAPKHWMLDKL HHHHHCCCCHHHHHC | 45.21 | 23000965 | |
22 | Acetylation | PKHWMLDKLTGVFAP CCCHHHHHCCCCCCC | 43.94 | 22635387 | |
22 | Ubiquitination | PKHWMLDKLTGVFAP CCCHHHHHCCCCCCC | 43.94 | 23000965 | |
24 | Phosphorylation | HWMLDKLTGVFAPRP CHHHHHCCCCCCCCC | 36.72 | 20363803 | |
32 | Phosphorylation | GVFAPRPSTGPHKLR CCCCCCCCCCCCHHH | 47.47 | 28450419 | |
33 | Phosphorylation | VFAPRPSTGPHKLRE CCCCCCCCCCCHHHH | 58.37 | 28450419 | |
37 | Ubiquitination | RPSTGPHKLRECLPL CCCCCCCHHHHHHHH | 52.99 | 21890473 | |
53 | Methylation | VFLRNRLKYALTGDE HHHHHCHHHHHHHHH | 25.82 | 164157 | |
53 | Acetylation | VFLRNRLKYALTGDE HHHHHCHHHHHHHHH | 25.82 | 164157 | |
53 | Ubiquitination | VFLRNRLKYALTGDE HHHHHCHHHHHHHHH | 25.82 | 23000965 | |
54 | Phosphorylation | FLRNRLKYALTGDEV HHHHCHHHHHHHHHH | 16.07 | 28152594 | |
57 | Phosphorylation | NRLKYALTGDEVKKI HCHHHHHHHHHHHHH | 34.12 | 28152594 | |
62 | Ubiquitination | ALTGDEVKKICMQHF HHHHHHHHHHHHHHH | 34.08 | 21906983 | |
62 | Acetylation | ALTGDEVKKICMQHF HHHHHHHHHHHHHHH | 34.08 | 24470773 | |
62 | Neddylation | ALTGDEVKKICMQHF HHHHHHHHHHHHHHH | 34.08 | 32015554 | |
63 | Ubiquitination | LTGDEVKKICMQHFL HHHHHHHHHHHHHHC | 46.44 | 22817900 | |
75 | Ubiquitination | HFLKIDGKVRVDITY HHCEECCEEEEEEEE | 24.10 | - | |
91 | Phosphorylation | AGFIDVISIEKTGEH CCEEEEEEEEECCCE | 25.25 | - | |
125 | Ubiquitination | EAKYKLCKVRKITVG HHHHEEECEEEEEEC | 56.35 | - | |
130 | Phosphorylation | LCKVRKITVGTKGIP EECEEEEEECCCCCC | 18.87 | 20860994 | |
133 | Phosphorylation | VRKITVGTKGIPHLV EEEEEECCCCCCCEE | 23.04 | 20860994 | |
145 | Methylation | HLVTHDARTIRYPDP CEEECCCCCCCCCCC | 36.42 | - | |
146 | Phosphorylation | LVTHDARTIRYPDPL EEECCCCCCCCCCCE | 16.13 | 28152594 | |
148 | Methylation | THDARTIRYPDPLIK ECCCCCCCCCCCEEE | 36.00 | - | |
149 | Phosphorylation | HDARTIRYPDPLIKV CCCCCCCCCCCEEEC | 14.24 | 28152594 | |
171 | Phosphorylation | LGTGKITSFIKFDTG CCCCCEEEEEEECCC | 28.57 | 24719451 | |
211 | Ubiquitination | SCDVVHVKDANGNSF CCEEEEEECCCCCCE | 35.92 | 22817900 | |
217 | Phosphorylation | VKDANGNSFATRISN EECCCCCCEEEEEEE | 20.04 | 20068231 | |
220 | Phosphorylation | ANGNSFATRISNIFV CCCCCEEEEEEEEEE | 26.90 | 20068231 | |
233 | Acetylation | FVIGNGNKPWISLPR EEECCCCCCEEECCC | 43.03 | 66724929 | |
233 | Ubiquitination | FVIGNGNKPWISLPR EEECCCCCCEEECCC | 43.03 | 22817900 | |
233 | Neddylation | FVIGNGNKPWISLPR EEECCCCCCEEECCC | 43.03 | 32015554 | |
237 | Phosphorylation | NGNKPWISLPRGKGI CCCCCEEECCCCCCE | 28.58 | 28450419 | |
247 | Phosphorylation | RGKGIRLTIAEERDK CCCCEEEEEEHHHHH | 14.32 | 19007248 | |
259 | Ubiquitination | RDKRLAAKQSSG--- HHHHHHHHHCCC--- | 45.14 | 33845483 | |
261 | Phosphorylation | KRLAAKQSSG----- HHHHHHHCCC----- | 36.00 | 29514088 | |
262 | Phosphorylation | RLAAKQSSG------ HHHHHHCCC------ | 46.13 | 29514088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS4Y2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS4Y2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS4Y2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RS4Y2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-22, AND MASS SPECTROMETRY. |