UniProt ID | RS19_MOUSE | |
---|---|---|
UniProt AC | Q9CZX8 | |
Protein Name | 40S ribosomal protein S19 | |
Gene Name | Rps19 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 145 | |
Subcellular Localization | ||
Protein Description | Required for pre-rRNA processing and maturation of 40S ribosomal subunits.. | |
Protein Sequence | MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Acetylation | -MPGVTVKDVNQQEF -CCCCCCCCCCHHHH | 46.74 | 55170029 | |
23 | Acetylation | RALAAFLKKSGKLKV HHHHHHHHHHCCCCC | 38.14 | 23864654 | |
23 | Succinylation | RALAAFLKKSGKLKV HHHHHHHHHHCCCCC | 38.14 | 23954790 | |
23 | Malonylation | RALAAFLKKSGKLKV HHHHHHHHHHCCCCC | 38.14 | 26320211 | |
29 | Ubiquitination | LKKSGKLKVPEWVDT HHHHCCCCCCHHHHH | 60.26 | 27667366 | |
29 | Acetylation | LKKSGKLKVPEWVDT HHHHCCCCCCHHHHH | 60.26 | 22826441 | |
29 | Malonylation | LKKSGKLKVPEWVDT HHHHCCCCCCHHHHH | 60.26 | 26320211 | |
38 | Acetylation | PEWVDTVKLAKHKEL CHHHHHHHHHHCCCC | 44.83 | 22826441 | |
43 | Acetylation | TVKLAKHKELAPYDE HHHHHHCCCCCCCCC | 54.43 | 22826441 | |
48 | Phosphorylation | KHKELAPYDENWFYT HCCCCCCCCCCCCHH | 30.22 | - | |
59 | Phosphorylation | WFYTRAASTARHLYL CCHHHHHHHCCHHHH | 22.93 | 19200342 | |
67 | Methylation | TARHLYLRGGAGVGS HCCHHHHCCCCCCCC | 28.13 | 29232949 | |
74 | Phosphorylation | RGGAGVGSMTKIYGG CCCCCCCCCEEEECC | 22.37 | 30635358 | |
76 | Phosphorylation | GAGVGSMTKIYGGRQ CCCCCCCEEEECCCC | 18.91 | 30635358 | |
77 | Acetylation | AGVGSMTKIYGGRQR CCCCCCEEEECCCCC | 25.86 | 23806337 | |
77 | Succinylation | AGVGSMTKIYGGRQR CCCCCCEEEECCCCC | 25.86 | 23806337 | |
93 | Phosphorylation | GVRPSHFSRGSKSVA CCCHHHCCCCCHHHH | 30.24 | 29514104 | |
111 | Malonylation | LQALEGLKMVEKDQD HHHHHHHCCEEECCC | 52.32 | 26320211 | |
111 | Ubiquitination | LQALEGLKMVEKDQD HHHHHHHCCEEECCC | 52.32 | 27667366 | |
111 | Acetylation | LQALEGLKMVEKDQD HHHHHHHCCEEECCC | 52.32 | 22733758 | |
115 | Acetylation | EGLKMVEKDQDGGRK HHHCCEEECCCCCCE | 49.64 | 23806337 | |
122 | Ubiquitination | KDQDGGRKLTPQGQR ECCCCCCEECCCCHH | 61.05 | 27667366 | |
143 | Ubiquitination | GQVAAANKKH----- HHHHHHHCCC----- | 47.71 | 27667366 | |
143 | Succinylation | GQVAAANKKH----- HHHHHHHCCC----- | 47.71 | 23806337 | |
143 | Malonylation | GQVAAANKKH----- HHHHHHHCCC----- | 47.71 | 26320211 | |
143 | Succinylation | GQVAAANKKH----- HHHHHHHCCC----- | 47.71 | - | |
143 | Acetylation | GQVAAANKKH----- HHHHHHHCCC----- | 47.71 | 23806337 | |
144 | Malonylation | QVAAANKKH------ HHHHHHCCC------ | 55.12 | 25418362 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
59 | S | Phosphorylation | Kinase | CAMK1 | Q14012 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS19_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS19_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AROS_MOUSE | Rps19bp1 | physical | 16289379 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...