UniProt ID | AROS_MOUSE | |
---|---|---|
UniProt AC | Q8C6B9 | |
Protein Name | Active regulator of SIRT1 | |
Gene Name | Rps19bp1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 143 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Direct regulator of SIRT1. Enhances SIRT1-mediated deacetylation of p53/TP53, thereby participating in inhibition of p53/TP53-mediated transcriptional activity (By similarity).. | |
Protein Sequence | MSAALVRRGLELLAASEAPRAVPGQVQASGTPAKRTRRARAKASQALKLRNSAKGKAPKSALAEYQKRQCRDHLKANLKFMTSMRSTVPESVTQQILQQNQGRKACDRLVAKTKNKKKKKKKAEGTVFTEEDFQKFQREYFGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Citrullination | -MSAALVRRGLELLA -CCHHHHHHHHHHHH | 28.00 | - | |
7 | Citrullination | -MSAALVRRGLELLA -CCHHHHHHHHHHHH | 28.00 | 24463520 | |
29 | Phosphorylation | VPGQVQASGTPAKRT CCCCCCCCCCCCHHH | 26.55 | 25159016 | |
31 | Phosphorylation | GQVQASGTPAKRTRR CCCCCCCCCCHHHHH | 19.99 | 26824392 | |
85 | Methylation | LKFMTSMRSTVPESV HHHHHHHHCCCCHHH | 29.01 | 16188307 | |
86 | Phosphorylation | KFMTSMRSTVPESVT HHHHHHHCCCCHHHH | 25.72 | - | |
103 | Methylation | ILQQNQGRKACDRLV HHHHCHHHHHHHHHH | 17.40 | 16188315 | |
143 | Phosphorylation | FQREYFGS------- HHHHHHCC------- | 27.44 | 26643407 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AROS_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AROS_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AROS_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AROS_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...