RRN11_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RRN11_SCHPO
• UniProt AC: O94332
• Protein Name: RNA polymerase I-specific transcription initiation factor rrn11
• Gene Name: rrn11
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 200
• Subcellular Localization: Nucleus .
• Protein Description: Subunit of a multiprotein complex essential for the initiation of rDNA transcription by RNA polymerase I. Binding to the DNA template is dependent on the initial binding of other factors..
• Protein Sequence: MFSPCTVKEKRSTLRSVAPNPESSVIPPIPLPSRRYKTRHIDALCSLMHLCLLRKDYPRASRAFSLLLRSKSVDISKLWNIGLEILNKVNPEASSEYMERLIARYPARPSINNSYPNRNAEHFFPAYIMLLIQRQEYNKAMKLLDEYLLLPPYNQNPALHEYSGMLCFELAKEEASESERTKWIEKAKYNFSNAGIDVEL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RRN11_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RRN11_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RRN11_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RRN11_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RIA1_SCHPO	ria1	genetic	22681890
YBD1_SCHPO	SPBC16C6.01c	genetic	22681890
SEC6_SCHPO	sec6	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.