RPC8_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPC8_SCHPO
• UniProt AC: O94285
• Protein Name: DNA-directed RNA polymerase III subunit rpc8
• Gene Name: rpc25
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 203
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNA..
• Protein Sequence: MFLLSRFSDIISIHPSNFWKPTKEALAEEIHKKYANKVIQNIGLAICVYDFLKIGEGIIKYGDGSSYMNVVFRLIIFRPFRGEVMLGKIKSCSEEGIRVTISFFDDIFIPKDMLFDPCVFRPDERAWVWKIEGEDGSEGTELYFDIDEEIRFQIESEDFVDISPKRNKNATAITGTEALESVSPYTLIASCSRDGLGIPAWWK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RPC8_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RPC8_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPC8_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPC8_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SMC4_SCHPO	cut3	physical	19910488
TF3B_SCHPO	brf1	physical	19910488

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.