RPAC2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPAC2_SCHPO
• UniProt AC: Q09177
• Protein Name: DNA-directed RNA polymerases I and III subunit RPAC2
• Gene Name: rpc19
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 125
• Subcellular Localization: Nucleus.
• Protein Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively..
• Protein Sequence: MAAMTDVTDPSSVAMESATEKIIILPGHSADLTSVTFQIQKEDHTLGNSLRYVIMKNPEVEFCGYSIPHPSEAKMNFRIQTAPSTTAVDVLRKGLDDLIDLCDAVTEKFTEQLPRDTSTTMEVDG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MAAMTDVTDPSSVAM CCCCCCCCCHHHHHH	45.03	24763107
12	Phosphorylation	TDVTDPSSVAMESAT CCCCCHHHHHHHCCC	21.20	24763107
118	Phosphorylation	EQLPRDTSTTMEVDG HCCCCCCCCCEEECC	26.60	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RPAC2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPAC2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPAC2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RPAC1_SCHPO	rpc40	physical	10628857

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.