UniProt ID | RPAC1_SCHPO | |
---|---|---|
UniProt AC | O94616 | |
Protein Name | DNA-directed RNA polymerases I and III subunit RPAC1 | |
Gene Name | rpc40 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 348 | |
Subcellular Localization | Nucleus . | |
Protein Description | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).. | |
Protein Sequence | MAAVDRSRTEISVLSDRVTDVGSVDFPGYYFDEDNIWDLDKFKKNLKVSITSLDQETMVFEISGIDASIANAFRRILIAEIPTLAFEFVYIINNTSIIQDEVLSHRIGLVPISADPDMFKWFQHPLPGQEATHTDYDTVVFSLNKKCEFNKNAATDEKDPKRLYVNSEVYSGDLIWKPQGRQEERFADNPIRVVNPDIVVAKLRPGQEIDLEAHAILGIGQDHAKFSPVATASYRLLPTIHILSPIEGEDAVKFQKCFPKGVIELEEGPDGKKQARVADVRKDTVSRECLRHPEFADKVQLGRVRDHYLFSVESTGIMKPDVLFIKSIAVLKSKCLAVKSSLQNISSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MAAVDRSRTEISVL -CCCCCCCCCEEEEC | 38.81 | 29996109 | |
9 | Phosphorylation | AAVDRSRTEISVLSD CCCCCCCCEEEECCC | 38.63 | 29996109 | |
12 | Phosphorylation | DRSRTEISVLSDRVT CCCCCEEEECCCCCC | 15.69 | 29996109 | |
15 | Phosphorylation | RTEISVLSDRVTDVG CCEEEECCCCCCCCC | 22.63 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPAC1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPAC1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPAC1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RPAC1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...