UniProt ID | RORG_MOUSE | |
---|---|---|
UniProt AC | P51450 | |
Protein Name | Nuclear receptor ROR-gamma | |
Gene Name | Rorc | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 516 | |
Subcellular Localization | Nucleus . | |
Protein Description | Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of cellular differentiation, immunity, peripheral circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism. Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively. Recruits distinct combinations of cofactors to target gene regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts. [PubMed: 17666523] | |
Protein Sequence | MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSREEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
108 | Acetylation | VKFGRMSKKQRDSLH HHHCCCCHHHHHHHH | 43.51 | 7743837 | |
134 | Phosphorylation | QQEQVAKTPPAGSRG HHHHHHCCCCCCCCC | 25.43 | 23140645 | |
161 | Phosphorylation | GQLPLGASPDLPEAS CCCCCCCCCCCCHHH | 19.69 | 26026062 | |
197 | Phosphorylation | KTEVQGASCHLEYSP CCEECCCEEEEEECC | 14.64 | 27600695 | |
203 | Phosphorylation | ASCHLEYSPERGKAE CEEEEEECCCCCCCC | 15.77 | 19060867 | |
299 | Phosphorylation | RQRTNLFSREEVTSY HHHHCCCCHHHHHHH | 41.78 | 28059163 | |
397 | Phosphorylation | GCSELISSIFDFSHF CCHHHHHHHHCHHHH | 21.93 | - | |
505 | Phosphorylation | PLYKELFSTDVESPE HHHHHHHCCCCCCCC | 36.00 | - | |
510 | Phosphorylation | LFSTDVESPEGLSK- HHCCCCCCCCCCCC- | 28.27 | 27600695 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RORG_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RORG_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CHD4_MOUSE | Chd4 | physical | 15144897 | |
ITCH_MOUSE | Itch | physical | 27322655 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...