RNB_HHV11 - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RNB_HHV11
• UniProt AC: P04487
• Protein Name: RNA-binding protein
• Gene Name: US11
• Organism: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1).
• Sequence Length: 161
• Subcellular Localization: Host nucleus, host nucleolus . Host cytoplasm . Following infection, it is released into the cell cytoplasm.
• Protein Description: Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA..
• Protein Sequence: MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RNB_HHV11 !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RNB_HHV11 !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RNB_HHV11 !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RNB_HHV11 !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
APBP2_HUMAN	APPBP2	physical	12915535

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.