UniProt ID | RNAS2_HUMAN | |
---|---|---|
UniProt AC | P10153 | |
Protein Name | Non-secretory ribonuclease | |
Gene Name | RNASE2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 161 | |
Subcellular Localization | Lysosome . Cytoplasmic granule. Matrix of eosinophil's large specific granule. | |
Protein Description | This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.. | |
Protein Sequence | MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | C-linked_Glycosylation | VKPPQFTWAQWFETQ CCCCCCCHHHHHEEE | 6.42 | 7947762 | |
34 | C-linked_Glycosylation | VKPPQFTWAQWFETQ CCCCCCCHHHHHEEE | 6.42 | 7947762 | |
44 | N-linked_Glycosylation | WFETQHINMTSQQCT HHEEECCCCCHHHHH | 26.09 | 7947762 | |
60 | Nitrated tyrosine | AMQVINNYQRRCKNQ HHHHHHHHHHHHCCC | 10.02 | - | |
60 | Nitration | AMQVINNYQRRCKNQ HHHHHHHHHHHHCCC | 10.02 | 18694936 | |
60 | Nitration | AMQVINNYQRRCKNQ HHHHHHHHHHHHCCC | 10.02 | 18694936 | |
84 | N-linked_Glycosylation | NVVNVCGNPNMTCPS CHHHHCCCCCCCCCC | 21.46 | - | |
84 | N-linked_Glycosylation | NVVNVCGNPNMTCPS CHHHHCCCCCCCCCC | 21.46 | 12578357 | |
86 | N-linked_Glycosylation | VNVCGNPNMTCPSNK HHHCCCCCCCCCCCC | 42.25 | 7947762 | |
92 | N-linked_Glycosylation | PNMTCPSNKTRKNCH CCCCCCCCCCCCCCC | 34.56 | 7947762 | |
111 | N-linked_Glycosylation | QVPLIHCNLTTPSPQ CCCEEEEECCCCCCC | 26.68 | 7947762 | |
119 | N-linked_Glycosylation | LTTPSPQNISNCRYA CCCCCCCCCCCCEEC | 42.94 | 7947762 | |
150 | Phosphorylation | QRRDPPQYPVVPVHL CCCCCCCCCCCCCCH | 12.08 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RNAS2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RNAS2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RNAS2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PCP2_HUMAN | PCP2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
C-linked Glycosylation | |
Reference | PubMed |
"Recognition signal for C-mannosylation of Trp-7 in RNase 2 consistsof sequence Trp-x-x-Trp."; Krieg J., Hartmann S., Vicentini A., Glasner W., Hess D.,Hofsteenge J.; Mol. Biol. Cell 9:301-309(1998). Cited for: GLYCOSYLATION AT TRP-34. | |
"New type of linkage between a carbohydrate and a protein: C-glycosylation of a specific tryptophan residue in human RNase Us."; Hofsteenge J., Mueller D.R., de Beer T., Loeffler A., Richter W.J.,Vliegenthart J.F.G.; Biochemistry 33:13524-13530(1994). Cited for: GLYCOSYLATION AT TRP-34. | |
Nitration | |
Reference | PubMed |
"Post-translational tyrosine nitration of eosinophil granule toxinsmediated by eosinophil peroxidase."; Ulrich M., Petre A., Youhnovski N., Proemm F., Schirle M., Schumm M.,Pero R.S., Doyle A., Checkel J., Kita H., Thiyagarajan N.,Acharya K.R., Schmid-Grendelmeier P., Simon H.-U., Schwarz H.,Tsutsui M., Shimokawa H., Bellon G., Lee J.J., Przybylski M.,Doering G.; J. Biol. Chem. 283:28629-28640(2008). Cited for: NITRATION AT TYR-60. |