PCP2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PCP2_HUMAN
• UniProt AC: Q8IVA1
• Protein Name: Purkinje cell protein 2 homolog
• Gene Name: PCP2
• Organism: Homo sapiens (Human).
• Sequence Length: 136
• Protein Description: May function as a cell-type specific modulator for G protein-mediated cell signaling..
• Protein Sequence: MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	GPCAEAGSPDQEGFF CCCCCCCCCCCCHHH	32.14	28348404
44	Phosphorylation	RMEGQRCSLQAGPGQ CCCCCCEEEECCCCC	26.21	24719451
55	Phosphorylation	GPGQTTKSQSDPTPE CCCCCCCCCCCCCHH	32.59	28348404
57	Phosphorylation	GQTTKSQSDPTPEMD CCCCCCCCCCCHHHH	53.28	28348404
60	Phosphorylation	TKSQSDPTPEMDSLM CCCCCCCCHHHHHHH	36.55	20363803
72	Phosphorylation	SLMDMLASTQGRRMD HHHHHHHHCCCCCCC	19.80	20363803
73	Phosphorylation	LMDMLASTQGRRMDD HHHHHHHCCCCCCCC	29.45	20363803
87	Phosphorylation	DQRVTVSSLPGFQPV CCCEEECCCCCCCCC	33.96	27251275
106	Phosphorylation	GAQKRAGTLSPQPLL CCHHCCCCCCCCCCC	24.07	24719451
108	Phosphorylation	QKRAGTLSPQPLLTP HHCCCCCCCCCCCCC	22.71	24719451
114	Phosphorylation	LSPQPLLTPQDPTAL CCCCCCCCCCCCCCC	26.96	24719451
127	Phosphorylation	ALGFRRNSSPQPPTQ CCCCCCCCCCCCCCC	41.40	24719451
128	Phosphorylation	LGFRRNSSPQPPTQA CCCCCCCCCCCCCCC	30.97	28348404

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PCP2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PCP2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PCP2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GNAI3_HUMAN	GNAI3	physical	26186194
GNAI3_HUMAN	GNAI3	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.