UniProt ID | RL7_DROME | |
---|---|---|
UniProt AC | P32100 | |
Protein Name | 60S ribosomal protein L7 | |
Gene Name | RpL7 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 252 | |
Subcellular Localization | ||
Protein Description | Binds to G-rich structures in 28S rRNA and in mRNAs. Plays a regulatory role in the translation apparatus; inhibits cell-free translation of mRNAs (By similarity).. | |
Protein Sequence | MPAPVVKKPAAKKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNEYIKAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFTVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRKMV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | KLPAVPESKLKFSKK CCCCCCHHHCCCCHH | 36.90 | 22817900 | |
59 | Acetylation | ENLVRAEKYQNEYIK HHHHHHHHHHCHHHH | 51.67 | 21791702 | |
66 | Acetylation | KYQNEYIKAEQREIK HHHCHHHHHHHHHHH | 44.99 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL7_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL7_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL7_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LANC3_DROME | CG2061 | physical | 14605208 | |
ESM3_DROME | E(spl)m3-HLH | physical | 14605208 | |
LIS1_DROME | Lis-1 | physical | 14605208 | |
MED4_DROME | MED4 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...