LANC3_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LANC3_DROME
• UniProt AC: Q9Y0Y7
• Protein Name: LanC-like protein 3 homolog
• Gene Name: CG2061
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 419
• Protein Sequence: MERRYLKNPFPDFAGGENTPFASDEEHIKNLICTYVDAILEHCHPNSDDEDNRGDLYVGNAGIAFMFWKLNSCEQTRDLYPALDHAASFIRNAKVNANRYKKRSAERYSFLCGNAGIYAVSAAISQALKETEELSDDLANFKSGIPCSKEFMHTKYGCDEVLVGRAGYLSGCYWLNDVLPEKKITDDDLVSICQLIVTSGREYSKQNNSPCPLMYQYHGTEYLGAAHGLCAILHMLLDSPWFRTLPISAPAAELRDIKRSIDFFLELQDSDGNFPVALEDLRSGRDKRLVHWCHGAPGAVYVLAKAYLIFKEEKYLASLRRCADMVWKKGFLRKGPGICHGVAGNGYVFLLLFRLTNEMRYLYRAHKFMELLTNAEFKLRARTPDRPHSLYEGVAGTVCYLVDLLEPEQAYFPFMDVFH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	DFAGGENTPFASDEE CCCCCCCCCCCCCHH	18.58	19429919
104	Phosphorylation	ANRYKKRSAERYSFL CCHHCCCCHHHHHHH	43.28	29892262

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LANC3_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LANC3_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LANC3_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.