UniProt ID | RL28_DROME | |
---|---|---|
UniProt AC | Q9VZS5 | |
Protein Name | 60S ribosomal protein L28 | |
Gene Name | RpL28 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 144 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MATSSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKGFTAVLKKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLRSQKPAPVKGKKAEFAKGKKPE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Acetylation | RYSGIVHKKTLGVVP EEECEEECCCCEECC | 36.24 | 21791702 | |
61 | Acetylation | GVVPAADKKGFTAVL EECCCCCCCCCEEEE | 50.50 | 21791702 | |
87 | Acetylation | NTVRVDFKAGPRRSL CEEEEEECCCCHHHH | 48.23 | 21791702 | |
105 | Acetylation | KNLLIGSKYRKDLTQ HHHHHCHHHHHHHHH | 43.81 | 21791702 | |
119 | Phosphorylation | QAALRRASAVLRSQK HHHHHHHHHHHHCCC | 19.66 | 19429919 | |
139 | Acetylation | GKKAEFAKGKKPE-- CCCCCHHCCCCCC-- | 76.28 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL28_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL28_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL28_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
POXM_DROME | Poxm | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...