dbPTM

RL1B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RL1B_SCHPO
UniProt AC	O74836
Protein Name	60S ribosomal protein L1-B
Gene Name	rpl101
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	216
Subcellular Localization
Protein Description
Protein Sequence	MSKVSVASVRSNVEQILKGSEEKKRNFTETVELQIGLKNYDPQRDKRFSGTIKLPNVPRPNMAICILGDAHDLDRAKHGGVDAMSVDDLKKLNKNKKLVKKLAKKYDAFIASEVLIKQIPRLLGPGLSKAGKFPSPVSHADDLYGKITEVKSTIKFQLKKVLCLGVAVGHVEMSEEQLIANIMLAVNFLVSLLKKGWQNIGSLVVKSTMGKPHRLY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSKVSVASV ------CCCCCHHHH	41.59	29996109
5	Phosphorylation	---MSKVSVASVRSN ---CCCCCHHHHHHC	18.72	29996109
8	Phosphorylation	MSKVSVASVRSNVEQ CCCCCHHHHHHCHHH	18.86	28889911
11	Phosphorylation	VSVASVRSNVEQILK CCHHHHHHCHHHHHC	42.97	28889911
85	Phosphorylation	HGGVDAMSVDDLKKL HCCCCCCCHHHHHHH	24.90	28889911
128	Phosphorylation	RLLGPGLSKAGKFPS HHHCCCCCCCCCCCC	26.78	28889911
135	Phosphorylation	SKAGKFPSPVSHADD CCCCCCCCCCCCHHH	40.86	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RL1B_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RL1B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RL1B_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RL1B_SCHPO	rpl101	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RL1B_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-11, AND MASSSPECTROMETRY.	18257517 [Abstract]