RK121_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RK121_ARATH
• UniProt AC: P36210
• Protein Name: 50S ribosomal protein L12-1, chloroplastic
• Gene Name: RPL12A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 191
• Subcellular Localization: Plastid, chloroplast.
• Protein Sequence: MASTTLSIATTIRSSSYPTLASINHFPSRTTTIEFPSRFGGGSSSTLTHRATHLRPIAAVEAPEKIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPADGGAAAVVEEQTEFDVVINEVPSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTLEEAGAKVSIA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MASTTLSIATT ----CCCCEEEHHHH	23.40	19880383
10	Phosphorylation	STTLSIATTIRSSSY CCEEEHHHHHHHCCC	22.53	19880383
11	Phosphorylation	TTLSIATTIRSSSYP CEEEHHHHHHHCCCC	12.84	19880383
71	Phosphorylation	EKIEKIGSEISSLTL HHHHHHCHHHHHCCH	34.92	30291188
75	Phosphorylation	KIGSEISSLTLEEAR HHCHHHHHCCHHHHH	30.91	30291188
147	Phosphorylation	IKAVRALTSLALKEA HHHHHHHHHHHHHHH	22.25	25561503
148	Phosphorylation	KAVRALTSLALKEAK HHHHHHHHHHHHHHH	16.70	25561503
189	Phosphorylation	EEAGAKVSIA----- HHHCCCCCCC-----	16.46	29797451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RK121_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RK121_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RK121_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EFTM_ARATH	AT4G02930	physical	23225155

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.