dbPTM

RIT1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RIT1_MOUSE
UniProt AC	P70426
Protein Name	GTP-binding protein Rit1
Gene Name	Rit1
Organism	Mus musculus (Mouse).
Sequence Length	219
Subcellular Localization	Cell membrane.
Protein Description	Plays a crucial role in coupling NGF stimulation to the activation of both EPHB2 and MAPK14 signaling pathways and in NGF-dependent neuronal differentiation. Involved in ELK1 transactivation through the Ras-MAPK signaling cascade that mediates a wide variety of cellular functions, including cell proliferation, survival, and differentiation (By similarity)..
Protein Sequence	MESGARPIGSSCSSPAALSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVSKEEGLSLAREFSCPFFETSAAYRYYIDDVFHALVREIRKKEKELVLAMEKKAKPKNSVWKRLKSPFRRKKDSVT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	GARPIGSSCSSPAAL CCCCCCCCCCCHHHH	16.89	29514104
14	Phosphorylation	PIGSSCSSPAALSRE CCCCCCCCHHHHCCC	23.92	29514104
124	Phosphorylation	LIYRVRRTDDTPVVL HHHHHHCCCCCCEEE	27.88	28059163
127	Phosphorylation	RVRRTDDTPVVLVGN HHHCCCCCCEEEECC	22.31	28059163
195	Acetylation	ELVLAMEKKAKPKNS HHHHHHHCCCCCCCC	44.97	7610735
209	Phosphorylation	SVWKRLKSPFRRKKD CHHHHCCCCHHCCCC	33.59	25338131

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RIT1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RIT1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RIT1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RGL3_MOUSE	Rgl3	physical	10869344

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RIT1_MOUSE

Related Literatures of Post-Translational Modification