RGS18_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RGS18_HUMAN
• UniProt AC: Q9NS28
• Protein Name: Regulator of G-protein signaling 18
• Gene Name: RGS18
• Organism: Homo sapiens (Human).
• Sequence Length: 235
• Subcellular Localization: Cytoplasm.
• Protein Description: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i) alpha-1, G(i) alpha-2, G(i) alpha-3 and G(q) alpha..
• Protein Sequence: METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIWL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----METTLLFFSQ -----CCEEEEEEEC	22.80	29083192
4	Phosphorylation	----METTLLFFSQI ----CCEEEEEEECC	14.25	29083192
28	Phosphorylation	FFKLIHGSGKEETSK HHHHHCCCCCCCCCH	32.31	27535140
49	Phosphorylation	KEKRNRLSLLVQKPE HHHHHHHHHEEECCC	19.20	28060719
63	Phosphorylation	EFHEDTRSSRSGHLA CCCCCCCCCCCCCCC	31.99	29116813
64	Phosphorylation	FHEDTRSSRSGHLAK CCCCCCCCCCCCCCC	27.46	29116813
73	Phosphorylation	SGHLAKETRVSPEEA CCCCCCCCCCCHHHH	35.35	22210691
76	Phosphorylation	LAKETRVSPEEAVKW CCCCCCCCHHHHHHH	24.25	22210691
189	Phosphorylation	QLMEQDSYTRFLKSD HHHHCCHHHHHHHCC	15.38	-
198	Phosphorylation	RFLKSDIYLDLMEGR HHHHCCHHHHHHCCC	10.11	-
216	Phosphorylation	PTNLRRRSRSFTCNE CCCHHHHCCCEECCC	30.39	28060719
218	Phosphorylation	NLRRRSRSFTCNEFQ CHHHHCCCEECCCHH	26.59	28060719
220	Phosphorylation	RRRSRSFTCNEFQDV HHHCCCEECCCHHCC	18.70	28060719

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
216	S	Phosphorylation	Kinase	PRKACA	P17612	GPS
216	S	Phosphorylation	Kinase	PRKG1	Q13976	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RGS18_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RGS18_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GNAI3_HUMAN	GNAI3	physical	11563974
GNAQ_HUMAN	GNAQ	physical	11955952
GNAI3_HUMAN	GNAI3	physical	11955952
GNAI2_HUMAN	GNAI2	physical	11955952
GNAI1_HUMAN	GNAI1	physical	11955952
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.