UniProt ID | RFPLA_HUMAN | |
---|---|---|
UniProt AC | A6NLU0 | |
Protein Name | Ret finger protein-like 4A | |
Gene Name | RFPL4A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 287 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVLSSEHGFLTVGCREGKVFAASTVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNVSDGCHIYTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSAASAPVSSEGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Ubiquitination | --MAEHFKQIIRCPV --CHHHHHHHHCCCC | 42.36 | 23000965 | |
63 | Ubiquitination | SQKDDIKPKYKLRAL ECCCCCCCHHHHHHH | 45.61 | 23000965 | |
72 | Phosphorylation | YKLRALVSIIKELEP HHHHHHHHHHHHHCH | 21.32 | 24719451 | |
83 | Phosphorylation | ELEPKLKSVLTMNPR HHCHHHHHHHHCCHH | 32.56 | - | |
112 | Phosphorylation | ANNYLIISEDLRSFR CCCEEEECCCHHHHH | 20.33 | 23186163 | |
188 | Phosphorylation | SSEHGFLTVGCREGK EECCCEEEEEECCCC | 16.76 | 27732954 | |
260 | Phosphorylation | FFAHKRGSQDDQSIL CCCCCCCCCCHHHHH | 34.17 | 22468782 | |
279 | Phosphorylation | VINPSAASAPVSSEG CCCCCCCCCCCCCCC | 32.59 | 22468782 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RFPLA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RFPLA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RFPLA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RFPLA_HUMAN | RFPL4A | physical | 16364311 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...