| UniProt ID | RET1_MOUSE | |
|---|---|---|
| UniProt AC | Q00915 | |
| Protein Name | Retinol-binding protein 1 | |
| Gene Name | Rbp1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 135 | |
| Subcellular Localization | Cytoplasm . Lipid droplet . | |
| Protein Description | Cytoplasmic retinol-binding protein. Accepts retinol from the transport protein STRA6, and thereby contributes to retinol uptake, storage and retinoid homeostasis.. | |
| Protein Sequence | MPVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRAEGVICKQVFKKVH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 38 | Acetylation | RKIANLLKPDKEIVQ HHHHHHHCCCHHHCC | 55.10 | 23954790 | |
| 56 | Phosphorylation | HMIIRTLSTFRNYIM CEEEEEHHHHHHHHH | 25.53 | 29899451 | |
| 128 | Acetylation | RAEGVICKQVFKKVH ECCCEEEHHHHHHCC | 38.07 | 22826441 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RET1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RET1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RET1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SEM4A_MOUSE | Sema4a | physical | 22465952 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...