RET1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RET1_MOUSE
• UniProt AC: Q00915
• Protein Name: Retinol-binding protein 1
• Gene Name: Rbp1
• Organism: Mus musculus (Mouse).
• Sequence Length: 135
• Subcellular Localization: Cytoplasm . Lipid droplet .
• Protein Description: Cytoplasmic retinol-binding protein. Accepts retinol from the transport protein STRA6, and thereby contributes to retinol uptake, storage and retinoid homeostasis..
• Protein Sequence: MPVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRAEGVICKQVFKKVH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Acetylation	RKIANLLKPDKEIVQ HHHHHHHCCCHHHCC	55.10	23954790
56	Phosphorylation	HMIIRTLSTFRNYIM CEEEEEHHHHHHHHH	25.53	29899451
128	Acetylation	RAEGVICKQVFKKVH ECCCEEEHHHHHHCC	38.07	22826441

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RET1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RET1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RET1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SEM4A_MOUSE	Sema4a	physical	22465952

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.