REM1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: REM1_HUMAN
• UniProt AC: O75628
• Protein Name: GTP-binding protein REM 1
• Gene Name: REM1
• Organism: Homo sapiens (Human).
• Sequence Length: 298
• Protein Description: Promotes endothelial cell sprouting and actin cytoskeletal reorganization. May be involved in angiogenesis. May function in Ca(2+) signaling..
• Protein Sequence: MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEKLDKSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSARRRALKARSKSCHNLAVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	TPLHRRASTPLPLSP CCCCCCCCCCCCCCC	28.84	23911959
19	Phosphorylation	PLHRRASTPLPLSPR CCCCCCCCCCCCCCC	28.06	24670416
24	Phosphorylation	ASTPLPLSPRGHQPG CCCCCCCCCCCCCCC	15.60	24670416
49	Phosphorylation	QHPRLGQSASLNPPT CCCCCCCCCCCCCCC	20.30	29507054
51	Phosphorylation	PRLGQSASLNPPTQK CCCCCCCCCCCCCCC	33.65	27499020
168	Phosphorylation	YSIADRGSFESASEL EEEECCCCCCCHHHH	27.08	26307563
171	Phosphorylation	ADRGSFESASELRIQ ECCCCCCCHHHHHHH	34.78	26307563
173	Phosphorylation	RGSFESASELRIQLR CCCCCCHHHHHHHHH	46.58	26307563
250	Phosphorylation	LRLRRRDSAAKEPPA HHHHCHHHCCCCCCC	28.45	29970186
289	Phosphorylation	RRALKARSKSCHNLA HHHHHHHCCCCCCCC	33.51	24719451
291	Phosphorylation	ALKARSKSCHNLAVL HHHHHCCCCCCCCCC	23.12	29507054

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
18	S	Phosphorylation	Kinase	PRKD1	Q15139	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of REM1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of REM1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
1433Z_HUMAN	YWHAZ	physical	10441394
BUD23_HUMAN	WBSCR22	physical	22939629

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.