UniProt ID | RBX2_MOUSE | |
---|---|---|
UniProt AC | Q9WTZ1 | |
Protein Name | RING-box protein 2 | |
Gene Name | Rnf7 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 113 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (By similarity). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (By similarity). Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents (By similarity).. | |
Protein Sequence | MADVEDGEEPCVLSSHSGSAGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADVEDGEE ------CCCCCCCCC | 29.56 | - | |
14 | Phosphorylation | GEEPCVLSSHSGSAG CCCCEEEEECCCCCC | 12.95 | 25293948 | |
15 | Phosphorylation | EEPCVLSSHSGSAGS CCCEEEEECCCCCCC | 19.94 | 25293948 | |
17 | Phosphorylation | PCVLSSHSGSAGSKS CEEEEECCCCCCCCC | 36.07 | 25293948 | |
19 | Phosphorylation | VLSSHSGSAGSKSGG EEEECCCCCCCCCCC | 32.26 | 25293948 | |
22 | Phosphorylation | SHSGSAGSKSGGDKM ECCCCCCCCCCCCCC | 24.30 | 25293948 | |
28 | Acetylation | GSKSGGDKMFSLKKW CCCCCCCCCEEECCC | 45.15 | 23806337 | |
61 | S-nitrosocysteine | RVQVMDACLRCQAEN EHHHHHHHHHHCCCC | 1.83 | - | |
61 | S-nitrosylation | RVQVMDACLRCQAEN EHHHHHHHHHHCCCC | 1.83 | 21278135 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RBX2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RBX2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RBX2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JUNB_MOUSE | Junb | physical | 25622904 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...