RBX2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RBX2_MOUSE
• UniProt AC: Q9WTZ1
• Protein Name: RING-box protein 2
• Gene Name: Rnf7
• Organism: Mus musculus (Mouse).
• Sequence Length: 113
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (By similarity). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (By similarity). Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents (By similarity)..
• Protein Sequence: MADVEDGEEPCVLSSHSGSAGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MADVEDGEE ------CCCCCCCCC	29.56	-
14	Phosphorylation	GEEPCVLSSHSGSAG CCCCEEEEECCCCCC	12.95	25293948
15	Phosphorylation	EEPCVLSSHSGSAGS CCCEEEEECCCCCCC	19.94	25293948
17	Phosphorylation	PCVLSSHSGSAGSKS CEEEEECCCCCCCCC	36.07	25293948
19	Phosphorylation	VLSSHSGSAGSKSGG EEEECCCCCCCCCCC	32.26	25293948
22	Phosphorylation	SHSGSAGSKSGGDKM ECCCCCCCCCCCCCC	24.30	25293948
28	Acetylation	GSKSGGDKMFSLKKW CCCCCCCCCEEECCC	45.15	23806337
61	S-nitrosocysteine	RVQVMDACLRCQAEN EHHHHHHHHHHCCCC	1.83	-
61	S-nitrosylation	RVQVMDACLRCQAEN EHHHHHHHHHHCCCC	1.83	21278135

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RBX2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RBX2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RBX2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
JUNB_MOUSE	Junb	physical	25622904

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.