RBM38_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RBM38_HUMAN
• UniProt AC: Q9H0Z9
• Protein Name: RNA-binding protein 38
• Gene Name: RBM38
• Organism: Homo sapiens (Human).
• Sequence Length: 239
• Subcellular Localization: Cytoplasm, cytosol . Nucleus .
• Protein Description: RNA-binding protein that specifically bind the 3'-UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Plays a role in myogenic differentiation..
• Protein Sequence: MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	Phosphorylation	APGAMHGSQKDTTFT CCCCCCCCCCCCCEE	21.27	22468782
29	Ubiquitination	GAMHGSQKDTTFTKI CCCCCCCCCCCEEEE	59.75	-
85	Methylation	GFVTMADRAAAERAC EEEEHHHHHHHHHHC	19.31	-
93	Ubiquitination	AAAERACKDPNPIID HHHHHHCCCCCCCCC	75.20	33845483
103	Ubiquitination	NPIIDGRKANVNLAY CCCCCCCCCCCCEEE	50.25	29967540
110	Phosphorylation	KANVNLAYLGAKPRS CCCCCEEECCCCCCC	14.61	18187866
114	Ubiquitination	NLAYLGAKPRSLQTG CEEECCCCCCCCCCC	38.88	2190698
114 (in isoform 1)	Ubiquitination	-	38.88	21906983
114 (in isoform 2)	Ubiquitination	-	38.88	21906983
135	Ubiquitination	QLHPTLIQRTYGLTP ECCHHHHHHHHCCCC	34.47	29967540
195	Phosphorylation	DQYPYAASPATAASF CCCCCCCCHHHHHHH	13.59	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
195	S	Phosphorylation	Kinase	GSK3B	P49841	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RBM38_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RBM38_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZN363_HUMAN	RCHY1	physical	21988832
MDM2_HUMAN	MDM2	physical	22710720

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.