dbPTM

RAR1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAR1_ARATH
UniProt AC	Q9SE33
Protein Name	Cysteine and histidine-rich domain-containing protein RAR1
Gene Name	RAR1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	226
Subcellular Localization
Protein Description	Required specifically for plant innate immunity. Is essential for resistance conferred by multiple R genes recognizing different bacterial and oomycete pathogen isolates like avirulent P.syringae or H.parasitica (downy mildew). Contributes additively with SGT1B to RPP5-dependent resistance. Functions as positive regulator of RPS5 accumulation by assisting its stabilization. May function as co-chaperone of HSP90-2 to positively regulate the steady-state accumulation of RPM1 and protect it from SGT1-mediated degradation. Acts as negative regulator of pathogen-associated molecular pattern (PAMP)-triggered immunity..
Protein Sequence	MEVGSATKKLQCQRIGCNAMFTDDDNPQGSCQFHASGPFFHDGMKEWSCCKQRSHDFSLFLEIPGCKTGKHTTEKPVLAKSVPKHPVAAPTSSPDANAATKDSCSRCRQGFFCSDHGSQPKEQIKQTLNTPGQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCDVHVKEFDEFMEIPPCTKGWHSSSPDPAV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
91	Phosphorylation	KHPVAAPTSSPDANA CCCCCCCCCCCCCCC	36.79	23328941
93	Phosphorylation	PVAAPTSSPDANAAT CCCCCCCCCCCCCCC	29.31	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAR1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAR1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAR1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SGT1A_ARATH	SGT1A	physical	11847307
SGT1B_ARATH	SGT1B	physical	11847307
HS901_ARATH	HSP90.1	physical	20670895
MD37E_ARATH	HSC70-1	physical	18065690
HS901_ARATH	HSP90.1	physical	18065690
SGT1B_ARATH	SGT1B	physical	18065690
SGT1B_ARATH	SGT1B	physical	18032631

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAR1_ARATH

Related Literatures of Post-Translational Modification