UniProt ID | RAH1C_ARATH | |
---|---|---|
UniProt AC | Q9SMR4 | |
Protein Name | Ras-related protein RABH1c | |
Gene Name | RABH1C | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 214 | |
Subcellular Localization |
Golgi apparatus membrane Lipid-anchor . Cytoplasm, cytosol . |
|
Protein Description | Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER) (By similarity).. | |
Protein Sequence | MASVSPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSNRQTFLNTSKWIEDVHRERGQSNVIIVLVGNKTDLVEKRQVSISEGEDKGKEYGVMFIETSAKENFNIKALFRKIAAALPGVDSYSLATKSDDMVDVNLKTTSNSSQGEQQGGAGGGGGCSC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
212 | Geranylgeranylation | GAGGGGGCSC----- CCCCCCCCCC----- | 4.20 | - | |
214 | Geranylgeranylation | GGGGGCSC------- CCCCCCCC------- | 8.22 | - | |
214 | Methylation | GGGGGCSC------- CCCCCCCC------- | 8.22 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAH1C_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAH1C_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAH1C_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GRIP_ARATH | ATGRIP | physical | 19490533 | |
GOGC5_ARATH | GC5 | physical | 19490533 | |
VP52A_ARATH | POK | physical | 19490533 | |
GOGC5_ARATH | GC5 | physical | 18182439 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...