RAH1C_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAH1C_ARATH
• UniProt AC: Q9SMR4
• Protein Name: Ras-related protein RABH1c
• Gene Name: RABH1C
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 214
• Subcellular Localization: Golgi apparatus membrane ; Lipid-anchor . Cytoplasm, cytosol .
• Protein Description: Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER) (By similarity)..
• Protein Sequence: MASVSPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSNRQTFLNTSKWIEDVHRERGQSNVIIVLVGNKTDLVEKRQVSISEGEDKGKEYGVMFIETSAKENFNIKALFRKIAAALPGVDSYSLATKSDDMVDVNLKTTSNSSQGEQQGGAGGGGGCSC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
212	Geranylgeranylation	GAGGGGGCSC----- CCCCCCCCCC-----	4.20	-
214	Geranylgeranylation	GGGGGCSC------- CCCCCCCC-------	8.22	-
214	Methylation	GGGGGCSC------- CCCCCCCC-------	8.22	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAH1C_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAH1C_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAH1C_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GRIP_ARATH	ATGRIP	physical	19490533
GOGC5_ARATH	GC5	physical	19490533
VP52A_ARATH	POK	physical	19490533
GOGC5_ARATH	GC5	physical	18182439

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.