UniProt ID | RAC1_RAT | |
---|---|---|
UniProt AC | Q6RUV5 | |
Protein Name | Ras-related C3 botulinum toxin substrate 1 | |
Gene Name | Rac1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 192 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side. Melanosome. Cytoplasm. Inner surface of plasma membrane possibly with attachment requiring prenylation of the C-terminal cysteine (By similarity). Found in the ruffled border (a late endosomal-like compa |
|
Protein Description | Plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization, neurons adhesion, migration and differentiation, and growth-factor induced formation of membrane ruffles. Rac1 p21/rho GDI heterodimer is the active component of the cytosolic factor sigma 1, which is involved in stimulation of the NADPH oxidase activity in macrophages. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. Stimulates PKN2 kinase activity. In concert with RAB7A, plays a role in regulating the formation of RBs (ruffled borders) in osteoclasts. In glioma cells, promotes cell migration and invasion. In podocytes, promotes nuclear shuttling of NR3C2; this modulation is required for a proper kidney functioning. Required for atypical chemokine receptor ACKR2-induced LIMK1-PAK1-dependent phosphorylation of cofilin (CFL1) and for up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. In synapses, seems to mediate the regulation of F-actin cluster formation performed by SHANK3.. | |
Protein Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Phosphorylation | DTAGQEDYDRLRPLS CCCCCCCHHHCCCCC | 11.38 | 22276854 | |
116 | Ubiquitination | PIILVGTKLDLRDDK CEEEEEECCCCCCCH | 33.79 | - | |
123 | Acetylation | KLDLRDDKDTIEKLK CCCCCCCHHHHHHHH | 62.15 | 72600163 | |
123 | Ubiquitination | KLDLRDDKDTIEKLK CCCCCCCHHHHHHHH | 62.15 | - | |
128 | Ubiquitination | DDKDTIEKLKEKKLT CCHHHHHHHHHCCCC | 62.09 | - | |
133 | Ubiquitination | IEKLKEKKLTPITYP HHHHHHCCCCCCCCH | 59.70 | - | |
147 | Acetylation | PQGLAMAKEIGAVKY HHHHHHHHHHCCEEE | 36.46 | 22902405 | |
147 | Ubiquitination | PQGLAMAKEIGAVKY HHHHHHHHHHCCEEE | 36.46 | - | |
153 | Acetylation | AKEIGAVKYLECSAL HHHHCCEEEEECHHH | 43.51 | 22902405 | |
166 | Acetylation | ALTQRGLKTVFDEAI HHHHHCHHHHHHHHH | 45.53 | 24217241 | |
166 | Ubiquitination | ALTQRGLKTVFDEAI HHHHHCHHHHHHHHH | 45.53 | - | |
167 | Phosphorylation | LTQRGLKTVFDEAIR HHHHCHHHHHHHHHH | 31.29 | 25403869 | |
183 | Ubiquitination | VLCPPPVKKRKRKCL HCCCCCCCCCCCCEE | 53.27 | - | |
184 | Ubiquitination | LCPPPVKKRKRKCLL CCCCCCCCCCCCEEC | 64.48 | - | |
189 | Methylation | VKKRKRKCLLL---- CCCCCCCEECC---- | 3.62 | - | |
189 | Geranylgeranylation | VKKRKRKCLLL---- CCCCCCCEECC---- | 3.62 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAC1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAC1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAC1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...