| UniProt ID | RABX5_MOUSE | |
|---|---|---|
| UniProt AC | Q9JM13 | |
| Protein Name | Rab5 GDP/GTP exchange factor | |
| Gene Name | Rabgef1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 491 | |
| Subcellular Localization | Cytoplasm. Early endosome. Recycling endosome. | |
| Protein Description | Rab effector protein acting as linker between gamma-adaptin, RAB4A or RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates nucleotide exchange on RAB5A (By similarity). Can act as a ubiquitin ligase (By similarity).. | |
| Protein Sequence | MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQRQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRAGSKKEIQEAKAPSPSINRQTSIETDRVTKEFIDFLKTFHKTGQEVYKQTKMFLEAMPYKRDLSIEEQSECTQDFYQNVAERMQTRGKVPPEKVEKIMDQIEKHIMTRLYKFVFCPETTDDEKKDLAIQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITRCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESESWPPEACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPPLQPQVYAG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Acetylation | ----MSLKSERRGIH ----CCCCCCCCCCC | 42.85 | 19850049 | |
| 85 | Ubiquitination | AQSLTFSKFEEKKTN CHHCCCHHHCHHHCC | 53.24 | 22790023 | |
| 89 | Ubiquitination | TFSKFEEKKTNEKTR CCHHHCHHHCCCCCC | 58.67 | - | |
| 103 | Ubiquitination | RKVTTVKKFFSASSR CCCHHHHHHHCCCCC | 47.51 | 22790023 | |
| 106 | Phosphorylation | TTVKKFFSASSRAGS HHHHHHHCCCCCCCC | 30.30 | 21454597 | |
| 108 | Phosphorylation | VKKFFSASSRAGSKK HHHHHCCCCCCCCHH | 21.11 | 23375375 | |
| 109 | Phosphorylation | KKFFSASSRAGSKKE HHHHCCCCCCCCHHH | 26.35 | 23375375 | |
| 113 | Phosphorylation | SASSRAGSKKEIQEA CCCCCCCCHHHHHHC | 39.30 | 26824392 | |
| 121 | Ubiquitination | KKEIQEAKAPSPSIN HHHHHHCCCCCCCCC | 61.14 | 27667366 | |
| 124 | Phosphorylation | IQEAKAPSPSINRQT HHHCCCCCCCCCCCC | 35.82 | 27087446 | |
| 126 | Phosphorylation | EAKAPSPSINRQTSI HCCCCCCCCCCCCCC | 36.51 | 25266776 | |
| 131 | Phosphorylation | SPSINRQTSIETDRV CCCCCCCCCCCCHHH | 28.56 | 25521595 | |
| 132 | Phosphorylation | PSINRQTSIETDRVT CCCCCCCCCCCHHHH | 15.30 | 25521595 | |
| 135 | Phosphorylation | NRQTSIETDRVTKEF CCCCCCCCHHHHHHH | 27.69 | 23375375 | |
| 139 | Phosphorylation | SIETDRVTKEFIDFL CCCCHHHHHHHHHHH | 26.25 | 26643407 | |
| 151 | Acetylation | DFLKTFHKTGQEVYK HHHHHHHHHHHHHHH | 50.59 | - | |
| 158 | Ubiquitination | KTGQEVYKQTKMFLE HHHHHHHHHHHHHHH | 57.58 | 27667366 | |
| 159 | Ubiquitination | TGQEVYKQTKMFLEA HHHHHHHHHHHHHHH | 28.77 | 27667366 | |
| 170 | Ubiquitination | FLEAMPYKRDLSIEE HHHHCCCCCCCCHHH | 33.30 | 22790023 | |
| 170 | Acetylation | FLEAMPYKRDLSIEE HHHHCCCCCCCCHHH | 33.30 | - | |
| 176 | Ubiquitination | YKRDLSIEEQSECTQ CCCCCCHHHHHHHHH | 46.75 | 27667366 | |
| 177 | Ubiquitination | KRDLSIEEQSECTQD CCCCCHHHHHHHHHH | 58.71 | 27667366 | |
| 206 | Acetylation | VPPEKVEKIMDQIEK CCHHHHHHHHHHHHH | 46.44 | 23954790 | |
| 303 | Ubiquitination | KHIFNAIKITKNEPA HHHHHHHHCCCCCCC | 41.74 | 22790023 | |
| 373 | Phosphorylation | IEKLDAQSLNLSQED HHHHCHHHCCCCHHH | 22.42 | 25619855 | |
| 377 | Phosphorylation | DAQSLNLSQEDFDRY CHHHCCCCHHHHHHH | 30.37 | 25619855 | |
| 384 | Phosphorylation | SQEDFDRYMSGQTSP CHHHHHHHHCCCCCC | 9.47 | 25619855 | |
| 386 | Phosphorylation | EDFDRYMSGQTSPRK HHHHHHHCCCCCCCC | 20.86 | 25619855 | |
| 389 | Phosphorylation | DRYMSGQTSPRKQES HHHHCCCCCCCCCCC | 44.20 | 25521595 | |
| 390 | Phosphorylation | RYMSGQTSPRKQESE HHHCCCCCCCCCCCC | 18.15 | 25521595 | |
| 442 | Phosphorylation | EKDLIDWTDGIAKEV HHHHHHHCHHHHHHH | 22.17 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RABX5_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RABX5_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RABX5_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RABE1_MOUSE | Rabep1 | physical | 9524116 | |
| GDIB_HUMAN | GDI2 | physical | 7782346 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...