| UniProt ID | RAB36_HUMAN | |
|---|---|---|
| UniProt AC | O95755 | |
| Protein Name | Ras-related protein Rab-36 | |
| Gene Name | RAB36 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 333 | |
| Subcellular Localization |
Golgi apparatus membrane Lipid-anchor. |
|
| Protein Description | Protein transport. Probably involved in vesicular traffic (By similarity).. | |
| Protein Sequence | MVIAGASWMLGRAAASPTQTPPTTSTIRVARRSRVALVAMVIAAAGSGGPGRAEPQLSQPSLDCGRMRSSLTPLGPPVSRDRVIASFPKWYTPEACLQLREHFHGQVSAACQRRNTGTVGLKLSKVVVVGDLYVGKTSLIHRFCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQEKFKCIASAYYRGAQVIITAFDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEADAVHLAREMQAEYWSVSAKTGENVKAFFSRVAALAFEQSVLQDLERQSSARLQVGNGDLIQMEGSPPETQESKRPSSLGCC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Phosphorylation | MLGRAAASPTQTPPT HCCCCCCCCCCCCCC | 24.61 | 24043423 | |
| 18 | Phosphorylation | GRAAASPTQTPPTTS CCCCCCCCCCCCCCC | 42.45 | 22468782 | |
| 20 | Phosphorylation | AAASPTQTPPTTSTI CCCCCCCCCCCCCHH | 33.44 | 22468782 | |
| 23 | Phosphorylation | SPTQTPPTTSTIRVA CCCCCCCCCCHHHHH | 34.28 | 22817900 | |
| 24 | Phosphorylation | PTQTPPTTSTIRVAR CCCCCCCCCHHHHHH | 29.64 | 22817900 | |
| 25 | Phosphorylation | TQTPPTTSTIRVARR CCCCCCCCHHHHHHH | 25.06 | 22817900 | |
| 26 | Phosphorylation | QTPPTTSTIRVARRS CCCCCCCHHHHHHHH | 15.65 | 22817900 | |
| 61 | Phosphorylation | EPQLSQPSLDCGRMR CCCCCCCCCCCCCCC | 29.24 | 23532336 | |
| 69 | Phosphorylation | LDCGRMRSSLTPLGP CCCCCCCCCCCCCCC | 21.98 | 29116813 | |
| 70 | Phosphorylation | DCGRMRSSLTPLGPP CCCCCCCCCCCCCCC | 26.37 | 29116813 | |
| 72 | Phosphorylation | GRMRSSLTPLGPPVS CCCCCCCCCCCCCCC | 20.58 | 24275569 | |
| 291 | Phosphorylation | AALAFEQSVLQDLER HHHHHHHHHHHHHHH | 20.00 | 28857561 | |
| 300 | Phosphorylation | LQDLERQSSARLQVG HHHHHHHHCCEEEEC | 31.99 | 28857561 | |
| 301 | Phosphorylation | QDLERQSSARLQVGN HHHHHHHCCEEEECC | 14.74 | 28857561 | |
| 332 | Geranylgeranylation | KRPSSLGCC------ CCCCCCCCC------ | 2.78 | - | |
| 333 | Geranylgeranylation | RPSSLGCC------- CCCCCCCC------- | 6.24 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB36_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAB36_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB36_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BICL2_MOUSE | Ccdc64b | physical | 20360680 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-23, AND MASSSPECTROMETRY. | |
