| UniProt ID | RAB24_HUMAN | |
|---|---|---|
| UniProt AC | Q969Q5 | |
| Protein Name | Ras-related protein Rab-24 | |
| Gene Name | RAB24 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 203 | |
| Subcellular Localization |
Cytoplasm, cytosol . Membrane Lipid-anchor . Only about 20-25% is recovered in the particulate fraction. |
|
| Protein Description | May be involved in autophagy-related processes.. | |
| Protein Sequence | MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | VVMLGKEYVGKTSLV EEECCCCCCCCCCHH | 20.28 | 14680817 | |
| 20 | Ubiquitination | LGKEYVGKTSLVERY CCCCCCCCCCHHHHH | 25.54 | 29967540 | |
| 37 | Phosphorylation | DRFLVGPYQNTIGAA CCCCCCCCCCCHHHH | 14.41 | - | |
| 51 | Phosphorylation | AFVAKVMSVGDRTVT HHHHHHHCCCCEEEE | 26.40 | 24670416 | |
| 70 | Phosphorylation | DTAGSERYEAMSRIY CCCCCHHHHHHHHHH | 12.18 | 27762562 | |
| 77 | Phosphorylation | YEAMSRIYYRGAKAA HHHHHHHHHHCCCEE | 5.99 | 27762562 | |
| 78 | Phosphorylation | EAMSRIYYRGAKAAI HHHHHHHHHCCCEEE | 10.53 | 27762562 | |
| 100 | Ubiquitination | SSSFERAKFWVKELR CCHHHHHHHHHHHHH | 46.08 | 22817900 | |
| 104 | Ubiquitination | ERAKFWVKELRSLEE HHHHHHHHHHHHHHC | 41.44 | 22817900 | |
| 121 | Ubiquitination | QIYLCGTKSDLLEED EEEECCCHHHHCHHH | 27.53 | 29967540 | |
| 147 | Ubiquitination | QDYADNIKAQLFETS HHHHHHHHHHHHCCC | 36.01 | 29967540 | |
| 156 | Ubiquitination | QLFETSSKTGQSVDE HHHCCCCCCCCCHHH | 57.34 | 21906983 | |
| 157 | Phosphorylation | LFETSSKTGQSVDEL HHCCCCCCCCCHHHH | 42.26 | 26471730 | |
| 160 | Phosphorylation | TSSKTGQSVDELFQK CCCCCCCCHHHHHHH | 32.64 | 28857561 | |
| 167 | Acetylation | SVDELFQKVAEDYVS CHHHHHHHHHHHHHH | 35.76 | 7681883 | |
| 172 | Phosphorylation | FQKVAEDYVSVAAFQ HHHHHHHHHHHEEEE | 6.02 | 14680817 | |
| 185 | Acetylation | FQVMTEDKGVDLGQK EEEEECCCCCCCCCC | 55.38 | 7681893 | |
| 200 | Geranylgeranylation | PNPYFYSCCHH---- CCCCCCCCCCC---- | 1.42 | - | |
| 201 | Geranylgeranylation | NPYFYSCCHH----- CCCCCCCCCC----- | 2.42 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB24_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAB24_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB24_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GDIB_HUMAN | GDI2 | physical | 20562859 | |
| GDIA_HUMAN | GDI1 | physical | 20562859 | |
| NSF_HUMAN | NSF | physical | 20562859 | |
| BICL2_MOUSE | Ccdc64b | physical | 20360680 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
