PX11B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PX11B_ARATH
• UniProt AC: Q9STY0
• Protein Name: Peroxisomal membrane protein 11B
• Gene Name: PEX11B
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 227
• Subcellular Localization: Peroxisome membrane ; Multi-pass membrane protein .
• Protein Description: Involved in peroxisomal proliferation. Promotes peroxisomal duplication, aggregation or elongation without fission..
• Protein Sequence: MSLDTVDKLVVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPEAADRFKKWEVASGLSRKAFRTGRSLTGFNALRRNPGATPMIRFLAVLANSGEMVYFFFDHFLWLSRIGSIDAKLAKKMSFISAFGESFGYTFFIIIDCIFIKQRLKSLKKLQHSTDEPKEEIGAKISEIRGDIVMRLMGISANVADLLIALAEIHPNPFCNHTITLGISGLVSAWAGWYRNWPS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	Phosphorylation	LSRKAFRTGRSLTGF CCHHHHHHCCCCCCH	30.41	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PX11B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PX11B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PX11B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARC5_ARATH	ARC5	physical	20179140
RAA1B_ARATH	RABA1b	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.