UniProt ID | PTN1_CHICK | |
---|---|---|
UniProt AC | O13016 | |
Protein Name | Tyrosine-protein phosphatase non-receptor type 1 | |
Gene Name | PTPN1 | |
Organism | Gallus gallus (Chicken). | |
Sequence Length | 434 | |
Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein Cytoplasmic side. |
|
Protein Description | May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET (By similarity).. | |
Protein Sequence | MEIEKEFHRLDQAASWAAIYQDIRHEASDFPCKVAKHPRNKNRNRYRDVSPFDHSRIKLNQGDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSIKCAQYWPRKEEKEMFFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEYGPVVVHCSAGIGRSGTFCLVDTCLLLMDKRKDPSSVDVKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAKFIMGDASVQEQWKELSNEDLDPPPEHTPPPPRPPKRTSEMHNGRMHEHAEFFPKHQVVEEEIRCSVSTAEETVSDGRVFSSVPLITDSTSQDTEIRRRTVGENLHVTAHKEESKSESVEEDDENMMTTWKPFLVNICMFTFLTAGAYLCYRVCFH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Phosphorylation | RNRYRDVSPFDHSRI CCCCCCCCCCCCCCC | 24.92 | - | |
66 | Phosphorylation | LNQGDNDYINASLIK CCCCCCCCCCHHHEE | 11.43 | - | |
152 | Phosphorylation | ISEDIKSYYTVRQLE EEHHHHHHEEEEEEH | 9.73 | - | |
153 | Phosphorylation | SEDIKSYYTVRQLEL EHHHHHHEEEEEEHH | 13.07 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
152 | Y | Phosphorylation | Kinase | FER | P16591 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTN1_CHICK !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTN1_CHICK !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PTN1_CHICK | PTPN1 | physical | 9600099 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...