PTI12_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PTI12_ARATH
• UniProt AC: O49339
• Protein Name: PTI1-like tyrosine-protein kinase 2
• Gene Name: PTI12
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 366
• Protein Description: Probable tyrosine-protein kinase involved in oxidative burst-mediated signaling leading to specific genes expression..
• Protein Sequence: MRRWICCGDKKGDSDLSNEEVHLKSPWQNSEANQKNQKPQAVVKPEAQKEALPIEVPPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQVSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLTRVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKPPAPAPAPVPES

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	CGDKKGDSDLSNEEV CCCCCCCCCCCCCEE	49.47	30291188
17	Phosphorylation	KKGDSDLSNEEVHLK CCCCCCCCCCEEECC	47.38	30291188
81	Phosphorylation	KSLIGEGSYGRVYYA CHHCCCCCCCEEEEE	21.80	25561503
82	Phosphorylation	SLIGEGSYGRVYYAT HHCCCCCCCEEEEEE	21.58	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PTI12_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PTI12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PTI12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
OXI1_ARATH	AGC2-1	physical	17040918

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.