PTI11_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PTI11_ARATH
• UniProt AC: Q8H1G6
• Protein Name: PTI1-like tyrosine-protein kinase 1
• Gene Name: PTI11
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 361
• Subcellular Localization: Cell membrane ; Peripheral membrane protein .
• Protein Sequence: MRKWICCTCQIEDSNEEQQLKSSQQQSDANHKNSKPAPVAKHEVKKEALPIEVPPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWITRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKPPAAAPAPES

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
78	Phosphorylation	KALIGEGSYGRVYYA CEEECCCCCCEEEEE	21.80	30407730
79	Phosphorylation	ALIGEGSYGRVYYAT EEECCCCCCEEEEEE	21.58	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PTI11_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PTI11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PTI11_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
OXI1_ARATH	AGC2-1	physical	17040918

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.