UniProt ID | PTHY_HUMAN | |
---|---|---|
UniProt AC | P01270 | |
Protein Name | Parathyroid hormone | |
Gene Name | PTH | |
Organism | Homo sapiens (Human). | |
Sequence Length | 115 | |
Subcellular Localization | Secreted. | |
Protein Description | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.. | |
Protein Sequence | MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Sulfoxidation | MIPAKDMAKVMIVML CCCHHHHHHHHHHHH | 16.07 | 8786987 | |
18 | Sulfoxidation | MIVMLAICFLTKSDG HHHHHHHHHHCCCCC | 1.58 | 8786987 | |
21 | Phosphorylation | MLAICFLTKSDGKSV HHHHHHHCCCCCCCC | 14.30 | - | |
23 | Phosphorylation | AICFLTKSDGKSVKK HHHHHCCCCCCCCCC | 46.49 | - | |
32 | Phosphorylation | GKSVKKRSVSEIQLM CCCCCCCCHHHHHHH | 38.58 | 22468782 | |
34 | Phosphorylation | SVKKRSVSEIQLMHN CCCCCCHHHHHHHHH | 30.17 | - | |
48 | Phosphorylation | NLGKHLNSMERVEWL HHHHHHHHHHHHHHH | 28.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTHY_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTHY_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTHY_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BAG6_HUMAN | BAG6 | physical | 16169070 | |
FEZ1_HUMAN | FEZ1 | physical | 16169070 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...