| UniProt ID | PSBR_ARATH | |
|---|---|---|
| UniProt AC | P27202 | |
| Protein Name | Photosystem II 10 kDa polypeptide, chloroplastic | |
| Gene Name | PSBR | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 140 | |
| Subcellular Localization | Plastid, chloroplast thylakoid membrane. Associated with the photosystem II complex. | |
| Protein Description | Associated with the oxygen-evolving complex of photosystem II.. | |
| Protein Sequence | MAASVMLSSVTLKPAGFTVEKTAARGLPSLTRARPSFKIVASGVKKIKTDKPFGINGSMDLRDGVDASGRKGKGYGVYKYVDKYGANVDGYSPIYNENEWSASGDVYKGGVTGLAIWAVTLAGILAGGALLVYNTSALAQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MAASVMLSSVT ----CCCEEEEEECE | 9.87 | 19880383 | |
| 8 | Phosphorylation | MAASVMLSSVTLKPA CCCEEEEEECEEECC | 12.50 | 19880383 | |
| 11 | Phosphorylation | SVMLSSVTLKPAGFT EEEEEECEEECCCEE | 30.89 | 19880383 | |
| 18 | Phosphorylation | TLKPAGFTVEKTAAR EEECCCEEEEHHHHC | 27.17 | 25561503 | |
| 49 | Phosphorylation | SGVKKIKTDKPFGIN CCCEEEECCCCCCCC | 53.37 | 25561503 | |
| 58 | Phosphorylation | KPFGINGSMDLRDGV CCCCCCCCEECCCCC | 12.48 | 30291188 | |
| 68 | Phosphorylation | LRDGVDASGRKGKGY CCCCCCCCCCCCCCC | 34.37 | 25561503 | |
| 75 | Nitration | SGRKGKGYGVYKYVD CCCCCCCCCCEEECC | 13.60 | - | |
| 78 | Nitration | KGKGYGVYKYVDKYG CCCCCCCEEECCCCC | 7.70 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSBR_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSBR_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSBR_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NAC89_ARATH | NAC089 | physical | 21798944 | |
| NIP11_ARATH | NLM1 | physical | 21798944 | |
| NUP35_ARATH | AT3G16310 | physical | 21798944 | |
| SUMO3_ARATH | SUMO3 | physical | 20855607 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-58, AND MASSSPECTROMETRY. | |
