UniProt ID | PSBR_ARATH | |
---|---|---|
UniProt AC | P27202 | |
Protein Name | Photosystem II 10 kDa polypeptide, chloroplastic | |
Gene Name | PSBR | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 140 | |
Subcellular Localization | Plastid, chloroplast thylakoid membrane. Associated with the photosystem II complex. | |
Protein Description | Associated with the oxygen-evolving complex of photosystem II.. | |
Protein Sequence | MAASVMLSSVTLKPAGFTVEKTAARGLPSLTRARPSFKIVASGVKKIKTDKPFGINGSMDLRDGVDASGRKGKGYGVYKYVDKYGANVDGYSPIYNENEWSASGDVYKGGVTGLAIWAVTLAGILAGGALLVYNTSALAQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MAASVMLSSVT ----CCCEEEEEECE | 9.87 | 19880383 | |
8 | Phosphorylation | MAASVMLSSVTLKPA CCCEEEEEECEEECC | 12.50 | 19880383 | |
11 | Phosphorylation | SVMLSSVTLKPAGFT EEEEEECEEECCCEE | 30.89 | 19880383 | |
18 | Phosphorylation | TLKPAGFTVEKTAAR EEECCCEEEEHHHHC | 27.17 | 25561503 | |
49 | Phosphorylation | SGVKKIKTDKPFGIN CCCEEEECCCCCCCC | 53.37 | 25561503 | |
58 | Phosphorylation | KPFGINGSMDLRDGV CCCCCCCCEECCCCC | 12.48 | 30291188 | |
68 | Phosphorylation | LRDGVDASGRKGKGY CCCCCCCCCCCCCCC | 34.37 | 25561503 | |
75 | Nitration | SGRKGKGYGVYKYVD CCCCCCCCCCEEECC | 13.60 | - | |
78 | Nitration | KGKGYGVYKYVDKYG CCCCCCCEEECCCCC | 7.70 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSBR_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSBR_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSBR_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NAC89_ARATH | NAC089 | physical | 21798944 | |
NIP11_ARATH | NLM1 | physical | 21798944 | |
NUP35_ARATH | AT3G16310 | physical | 21798944 | |
SUMO3_ARATH | SUMO3 | physical | 20855607 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-58, AND MASSSPECTROMETRY. |