| UniProt ID | PSBP1_ARATH | |
|---|---|---|
| UniProt AC | Q42029 | |
| Protein Name | Oxygen-evolving enhancer protein 2-1, chloroplastic | |
| Gene Name | PSBP1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 263 | |
| Subcellular Localization | Plastid, chloroplast thylakoid lumen . Associated with the photosystem II complex. | |
| Protein Description | May be involved in the regulation of photosystem II.. | |
| Protein Sequence | MAYSACFLHQSALASSAARSSSSSSSQRHVSLSKPVQIICKAQQSHEDDNSAVSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYPGQVLRFEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGFDNNAVATANILESSSQEVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVESAATSFSVA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 (in isoform 2) | Phosphorylation | - | 3.87 | 29654922 | |
| 8 (in isoform 2) | Phosphorylation | - | 3.46 | 29654922 | |
| 14 (in isoform 2) | Phosphorylation | - | 10.93 | 29654922 | |
| 79 | Nitration | VSPADAAYGEAANVF CCHHHHHHHHHHHHC | 19.74 | - | |
| 98 | Phosphorylation | TNTDFLPYNGDGFKV CCCCCCCCCCCCEEE | 33.65 | 19376835 | |
| 119 | Nitration | NPSKEIEYPGQVLRF CCCCCCCCCCEEEEE | 20.51 | - | |
| 133 | Phosphorylation | FEDNFDATSNLNVMV EECCCCCCCCEEEEE | 21.71 | 19376835 | |
| 134 | Phosphorylation | EDNFDATSNLNVMVT ECCCCCCCCEEEEEC | 40.83 | 23111157 | |
| 141 | Phosphorylation | SNLNVMVTPTDKKSI CCEEEEECCCCCCCC | 11.45 | 30291188 | |
| 143 | Phosphorylation | LNVMVTPTDKKSITD EEEEECCCCCCCCCC | 51.60 | 19376835 | |
| 147 | Phosphorylation | VTPTDKKSITDYGSP ECCCCCCCCCCCCCH | 36.14 | 22092075 | |
| 149 | Phosphorylation | PTDKKSITDYGSPEE CCCCCCCCCCCCHHH | 30.20 | 22092075 | |
| 151 | Phosphorylation | DKKSITDYGSPEEFL CCCCCCCCCCHHHHH | 15.74 | 22092075 | |
| 153 | Phosphorylation | KSITDYGSPEEFLSQ CCCCCCCCHHHHHHH | 23.94 | 22092075 | |
| 159 | Phosphorylation | GSPEEFLSQVNYLLG CCHHHHHHHHHHHHC | 37.09 | 27029354 | |
| 212 | Phosphorylation | YLSVLTRTADGDEGG EEEEEEEECCCCCCC | 24.70 | 22092075 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSBP1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSBP1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSBP1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| WAK1_ARATH | WAK1 | physical | 12767910 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-141 AND THR-143, ANDMASS SPECTROMETRY. | |
