| UniProt ID | PSAL_ARATH | |
|---|---|---|
| UniProt AC | Q9SUI4 | |
| Protein Name | Photosystem I reaction center subunit XI, chloroplastic | |
| Gene Name | PSAL | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 219 | |
| Subcellular Localization |
Plastid, chloroplast membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MAASASPMASQLRSSFSSASLSQRLAVPKGISGAPFGVSPTKRVSSFTVRAVKSDKTTFQVVQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLAHGFFLVGPFVKAGPLRNTAYAGSAGSLAAAGLVVILSMCLTIYGISSFKEGEPSIAPSLTLTGRKKQPDQLQTADGWAKFTGGFFFGGISGVTWAYFLLYVLDLPYFVK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Phosphorylation | PMASQLRSSFSSASL HHHHHHHHHCCCCCH | 44.31 | 19376835 | |
| 15 | Phosphorylation | MASQLRSSFSSASLS HHHHHHHHCCCCCHH | 23.78 | 19376835 | |
| 17 | Phosphorylation | SQLRSSFSSASLSQR HHHHHHCCCCCHHHH | 27.26 | 19376835 | |
| 18 | Phosphorylation | QLRSSFSSASLSQRL HHHHHCCCCCHHHHH | 21.62 | 19376835 | |
| 20 | Phosphorylation | RSSFSSASLSQRLAV HHHCCCCCHHHHHCC | 30.42 | 19376835 | |
| 22 | Phosphorylation | SFSSASLSQRLAVPK HCCCCCHHHHHCCCC | 15.68 | 19376835 | |
| 45 | Phosphorylation | VSPTKRVSSFTVRAV CCCCCCCCEEEEEEE | 24.62 | 29654922 | |
| 46 | Phosphorylation | SPTKRVSSFTVRAVK CCCCCCCEEEEEEEC | 23.29 | 19880383 | |
| 96 | Phosphorylation | SNLPGYRTAVNPLLR HCCCCHHHHHHHHHH | 26.86 | 29654922 | |
| 168 | Phosphorylation | GEPSIAPSLTLTGRK CCCCCCCCEEECCCC | 25.60 | 28295753 | |
| 170 | Phosphorylation | PSIAPSLTLTGRKKQ CCCCCCEEECCCCCC | 26.98 | 30291188 | |
| 172 | Phosphorylation | IAPSLTLTGRKKQPD CCCCEEECCCCCCCC | 29.70 | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSAL_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSAL_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSAL_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CUT1B_ARATH | PSI-P | physical | 18813226 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
