UniProt ID | CUT1B_ARATH | |
---|---|---|
UniProt AC | Q8LCA1 | |
Protein Name | Protein CURVATURE THYLAKOID 1B, chloroplastic | |
Gene Name | CURT1B | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 174 | |
Subcellular Localization |
Plastid, chloroplast thylakoid membrane Multi-pass membrane protein . Located almost exclusively at grana margins. |
|
Protein Description | Determines thylakoid architecture by inducing membrane curvature.. | |
Protein Sequence | MASLSVSSSSTIIDSRAPPSRLASASASSPSCISLPTLPIQSHTRAAKATAYCRKIVRNVVTRATTEVGEAPATTTEAETTELPEIVKTAQEAWEKVDDKYAIGSLAFAGVVALWGSAGMISAIDRLPLVPGVLELVGIGYTGWFTYKNLVFKPDREALFEKVKSTYKDILGSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Acetylation | VRNVVTRATTEVGEA HHHHHHHHCCCCCCC | 22223895 | ||
65 | Phosphorylation | RNVVTRATTEVGEAP HHHHHHHCCCCCCCC | 30291188 | ||
66 | Phosphorylation | NVVTRATTEVGEAPA HHHHHHCCCCCCCCC | 30291188 | ||
74 | Phosphorylation | EVGEAPATTTEAETT CCCCCCCCCCCCCCC | 30291188 | ||
75 | Phosphorylation | VGEAPATTTEAETTE CCCCCCCCCCCCCCC | 19376835 | ||
76 | Phosphorylation | GEAPATTTEAETTEL CCCCCCCCCCCCCCH | 27545962 | ||
80 | Phosphorylation | ATTTEAETTELPEIV CCCCCCCCCCHHHHH | 19376835 | ||
81 | Phosphorylation | TTTEAETTELPEIVK CCCCCCCCCHHHHHH | 27545962 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CUT1B_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CUT1B_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CUT1B_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...